DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and Pex1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_652016.1 Gene:Pex1 / 45460 FlyBaseID:FBgn0013563 Length:1006 Species:Drosophila melanogaster


Alignment Length:216 Identity:78/216 - (36%)
Similarity:124/216 - (57%) Gaps:15/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 PELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLF 306
            |.:......::..|:|||||||||||.:..|:.|..|.|... |.||::|.||:|:||.|||.||
  Fly   743 PTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIIS-VKGPELLAKYIGQSEENVRNLF 806

  Fly   307 AEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGVDQLNNILVIG 371
            ..|.....        .::.|||.|::..:||.  .::||.|.|||||||::|||:.|..:.||.
  Fly   807 NRARSARP--------CVLFFDEFDSLAPKRGH--DSTGVTDRVVNQLLTELDGVEGLQGVTVIA 861

  Fly   372 MTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNF 436
            .|:|.:::|.||||.||::..:|..||:...||:|....:..:    .:::.||....|..|.|:
  Fly   862 ATSRPELLDPALLRSGRIDRLVECPLPDAPARVRIFEALSSTL----SLDECVDFDWFAGKTANY 922

  Fly   437 SGAELEGLVRAAQSSAMNRLI 457
            :||:::.::.:|..:|:...:
  Fly   923 TGADIQSILTSANMAAVKEAL 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 78/216 (36%)
AAA 256..397 CDD:278434 62/140 (44%)
AAA 539..668 CDD:278434
Pex1NP_652016.1 PEX-1N 93..168 CDD:286361
SpoVK 479..974 CDD:223540 78/216 (36%)
P-loop_NTPase 480..604 CDD:304359
AAA 757..887 CDD:278434 62/140 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.