DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and nmd

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:390 Identity:109/390 - (27%)
Similarity:170/390 - (43%) Gaps:84/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GMALTVGQSLVFNFKDKKLLGLAVKSL----------EAIDPKSLGEGKDTAMRNVRFGRILGNT 181
            |..|:.||  :|    :.|:.|:|.||          ..:||.|..:.|...:...:..|:    
  Fly     8 GSDLSKGQ--IF----QVLVRLSVASLITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRL---- 62

  Fly   182 VVQFEKAENSSLNLQGKS----KGKVVRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPP 242
                  ||.....|:|:.    :..:....::..|.......|.|||    |:.:....|.|.|.
  Fly    63 ------AEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLD----SVIQELRESVVLPI 117

  Fly   243 ELVEQLGCKH------VKGILLYGPPGTGKTLMARQIGTMLNAREP--KIVN-GPQIL-DKYVGE 297
            :..:..  ||      .||:||:||||.||||:|:     ..|:|.  :.:| ...|| ||:.||
  Fly   118 QHKDLF--KHSKLWQAPKGVLLHGPPGCGKTLIAK-----ATAKEAGMRFINLDVAILTDKWYGE 175

  Fly   298 SEANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVV---NQLLTKID 359
            |:.....:|:.|    .|:.|    .||..||||:..:.|     |...|:...   .|.:...|
  Fly   176 SQKLTSAVFSLA----SRIEP----CIIFIDEIDSFLRSR-----NMNDHEATAMMKTQFMMLWD 227

  Fly   360 GVDQLNN--ILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKIND 422
            |:....|  ::|:|.|||...:|:|::|  |:..|..|.||:|..|..||    |.:.:..:::.
  Fly   228 GLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDIL----KLILQSEEVSQ 286

  Fly   423 DVDNKEIAALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEA----MEKLKVNRDDFLHS 483
            |||...::.||..|||::|..:.|.|....|.:||     .:.||.|    ...:::..||.|.|
  Fly   287 DVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLI-----TSRDPSATALDRNNVRITMDDLLGS 346

  Fly   484  483
              Fly   347  346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 10/40 (25%)
SpoVK 242..699 CDD:223540 81/261 (31%)
AAA 256..397 CDD:278434 49/149 (33%)
AAA 539..668 CDD:278434
nmdNP_001285801.1 AAA 132..266 CDD:214640 51/153 (33%)
AAA 135..265 CDD:278434 49/149 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.