DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and spas

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster


Alignment Length:440 Identity:119/440 - (27%)
Similarity:183/440 - (41%) Gaps:111/440 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KKTVSQEPYDSDQMAKEFIMQFAGMALTVGQSLVFNFKDKKLLGLAVKSLEAIDPKSLGE----- 163
            |.|.|.:|..|            |..||:|        .|:.:.|||.:.....|::||.     
  Fly   362 KATTSAQPTAS------------GRKLTIG--------SKRPVNLAVANKSQTLPRNLGSKTSVG 406

  Fly   164 ------GKDTA-----MRNVRFGRILGNTVVQFEKAENSSLNLQGKSKG---------KVVRQSI 208
                  .|..|     .|....||   ||..|   ...:.:|..|.|..         |.|.|.:
  Fly   407 AVQRQPAKTAATPPAVRRQFSSGR---NTPPQ---RSRTPINNNGPSGSGASTPVVSVKGVEQKL 465

  Fly   209 INPDWDFGKMGIGGLDKEFNSIFRRAFASR------VFP---PELVEQLGCKHVKGILLYGPPGT 264
            :....|  ::..||...|:..|..:..|.:      :.|   |||...|... .||:||:||||.
  Fly   466 VQLILD--EIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAP-AKGLLLFGPPGN 527

  Fly   265 GKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHIIIFDE 329
            ||||:||.:.|..:|....| :...:..||||:.|..||.|||.|    :.:.|:    ||..||
  Fly   528 GKTLLARAVATECSATFLNI-SAASLTSKYVGDGEKLVRALFAVA----RHMQPS----IIFIDE 583

  Fly   330 IDAICKQRGSVAGNSGVHDT---VVNQLLTKIDGV---DQLNNILVIGMTNRRDMIDEALLRPGR 388
            :|::..:|     :|..|:.   :..:.|.:.||:   ...:.|:|:..|||...:|||.||  |
  Fly   584 VDSLLSER-----SSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--R 641

  Fly   389 LEVQMEISLPNEQGRVQILN---------IHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGL 444
            ...::.:|||:||.|..:||         :.|:.:|...||.|.....::.||.|:   |.||.:
  Fly   642 FTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKD---AALEPI 703

  Fly   445 -------VRAAQSSAMNRLIKAD-------AKVTVDPEAMEKLKVNRDDF 480
                   |:....|||..:.:.|       .:.:|.|:::...:....|:
  Fly   704 RELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDY 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 10/46 (22%)
SpoVK 242..699 CDD:223540 82/268 (31%)
AAA 256..397 CDD:278434 49/146 (34%)
AAA 539..668 CDD:278434
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 21/56 (38%)
AAA 515..652 CDD:214640 53/153 (35%)
AAA 519..650 CDD:278434 49/146 (34%)
Vps4_C <722..754 CDD:286426 4/32 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.