DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and CG16789

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_649910.3 Gene:CG16789 / 41154 FlyBaseID:FBgn0037712 Length:831 Species:Drosophila melanogaster


Alignment Length:400 Identity:76/400 - (19%)
Similarity:138/400 - (34%) Gaps:138/400 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 EVQMEISLPNEQGR----VQILN-------IHTKRMR----EFNKINDDVDNKEIAALTKNFSGA 439
            :::.||.|.|:..|    ..:|:       |::.:.:    ||.:..|||..:||..|       
  Fly   407 DIRAEIDLFNDTWRDKDETGVLSQAAYEDMIYSDKYQEVELEFRRAVDDVMRQEIELL------- 464

  Fly   440 ELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPAFGTAQEILDNMLA 504
                      .:|:.:.:|..:|.|.......|.|         .|.|:.|. .|.:.:.:.::.
  Fly   465 ----------QTAVGKKVKKSSKKTRRSGKKSKKK---------KEKDLTPD-RTTESLYEELVT 509

  Fly   505 RGVINWGAP---VSNLLEDGMLYVQQAKAPESSG-------------------------LVSVLV 541
            .|:|. ..|   :...|.|..|..:....| |.|                         :.|:|:
  Fly   510 NGIIR-KYPELRLKQFLGDKALTARIGTNP-SPGDIRQILTEYCILPLGSDAIHNCTPLIRSILL 572

  Fly   542 AGAPNSGKTALAAQL-----AKMSDFPFVKVCSPEDMVG--------------YTESAKCLHIRK 587
            ||...|||.||...:     |.:.|.      :|.::||              ..:.::.|....
  Fly   573 AGPKGSGKKALLHAICTEVGAVLFDL------TPANIVGKYPGKSGLIMLIHLVLKVSRLLQPAV 631

  Fly   588 IF-DDAYRSMLSCI-VVDNVERLLDYGSIGPRYSNMTLQALLVLLKKQPPKGRKLLILCTSSRRE 650
            || .||.|..:..| ..|..:         |:.....|..   |:|...|:.| ::.:.||:...
  Fly   632 IFMGDAERPFMKKIPKTDRTD---------PKRLKKDLPK---LIKNIAPEDR-VVFIGTSNLPW 683

  Fly   651 VLEEMEMLTAFTSVLHVPNLSKPDH----------------------VLAVLENTDIFSKGEIQA 693
            ..::..:.:.:...:::|   :||:                      ..|:.:.:|.::.|.|.|
  Fly   684 EADQKLLQSVYNRFIYIP---RPDYGAMSHAWKTLLHDYSGGISNLDTSAMAKISDGYTIGSIDA 745

  Fly   694 IGKK-MAGKR 702
            ..|: |..||
  Fly   746 CLKEVMTCKR 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 73/395 (18%)
AAA 256..397 CDD:278434 2/6 (33%)
AAA 539..668 CDD:278434 29/149 (19%)
CG16789NP_649910.3 AAA 568..704 CDD:214640 31/157 (20%)
AAA 570..702 CDD:278434 30/153 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.