DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and CG14183

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster


Alignment Length:638 Identity:121/638 - (18%)
Similarity:226/638 - (35%) Gaps:169/638 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 FNFKDKKLLGLAVKS-------LEAIDPKSLGEGKDTAMRNVRFGRILGNTVVQFEKA-----EN 190
            |.||..:.:.:.||.       |:|          |.:..|:.....:.:|.:..|:|     .|
  Fly   202 FTFKPDQAMSIPVKRTIFSADFLKA----------DESCENLIKKDDVADTAIDDEEALSAIQNN 256

  Fly   191 SSLNLQGKSKG----KVVRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCK 251
            ::..:|...:|    |:|:                         .|:.|...::        |.|
  Fly   257 AACKIQSCWRGYKTRKIVK-------------------------IRKRFKEELY--------GMK 288

  Fly   252 HVKGILLYGPPGTGKTLMARQIGTMLNAR-EPKIVN-------------GPQILDKYVGESEANV 302
            .::  .|..|..|..::|......||..: :...:|             .|.:::    :...::
  Fly   289 KIR--KLKRPNQTANSIMEMYKNEMLKKKLDEDFINLINDERTRLLQFRSPWMME----DISDHI 347

  Fly   303 RRLFAEAEEEEKRLGP-----NSGLHIIIFDEI-------DAICKQRGSVAGNSGVHDTVVNQLL 355
            |..|.|..:......|     ..|..:::.||.       :::.|:..|.|....:.|....:..
  Fly   348 RAWFKEFYDATGNFHPYPDPVKQGTVLVVIDETMTPMEFQESLGKKPLSKAELKKLRDKEKKEKR 412

  Fly   356 TKIDGVDQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRV-QILNIHTKRMRE--- 416
            .|.:.:.||.    :....||..:.:|    |.:::..|::.......: :.:..::|..|.   
  Fly   413 KKKEKLKQLK----MKEAKRRKKLRDA----GVIDIGYELTASKAIENIEETMKKYSKDWRNVDE 469

  Fly   417 -FNKINDDVD-----------NKEIAALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEA 469
             .||.:|.:.           ::|:..|...:...|.| |:|.|.:...:...|| .||....:.
  Fly   470 YLNKNHDPIKEWVTEEQLAKIHQEVRGLVDEYMRVEYE-LLREALAKDNDEKYKA-LKVKYPKKK 532

  Fly   470 MEKLK-----VNRDDFLHSLEHDIKPAFGTAQEI----LDNMLA------------RGVINWG-- 511
            .||.|     :..|..|.||.:::|.| |..:||    .|..:.            .|:...|  
  Fly   533 KEKRKKKPKDMTGDRTLESLYNELKDA-GIIEEIGHRDFDEFITDFNFVADDTRDEDGLTTLGPA 596

  Fly   512 -APVSNLLEDGMLYVQQAKAPESSGLVSVLVAGAPNSGKTALAAQLAKMSDFPFVKVCSPEDMVG 575
             ..:..::::.||.:.:...|:..   |:|:.|..||||..|...:|...|..|:.: |||:...
  Fly   597 KGDIKMVIQESMLGMGEFDVPKPK---SLLLIGPLNSGKRLLCEIIASELDAVFMNL-SPENTYK 657

  Fly   576 YTESAK-----CLHIRKIF-------DDAYRSMLSCIVVDNVERLLDYGSIGPRYSNMTLQALLV 628
            |.:..|     .|.:.|.|       ::|:|.....:..:.||       |.||....:|.:.::
  Fly   658 YAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVE-------INPRLLGTSLASKIL 715

  Fly   629 LLKKQPPKGRKLLILCTSSRREVLEEMEMLTAFTSVLHVPNLSKPDHVLAVLE 681
                :|.|....::|..:|.........:..||..||.:|........|..||
  Fly   716 ----KPLKKNDKIVLVGTSNMPWAANGGIKRAFQKVLLIPKCDYGTSFLLWLE 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 7/26 (27%)
SpoVK 242..699 CDD:223540 102/518 (20%)
AAA 256..397 CDD:278434 27/166 (16%)
AAA 539..668 CDD:278434 34/140 (24%)
CG14183NP_649172.3 AAA 622..751 CDD:278434 34/140 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.