DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and CG5776

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001260420.1 Gene:CG5776 / 34680 FlyBaseID:FBgn0032450 Length:799 Species:Drosophila melanogaster


Alignment Length:312 Identity:107/312 - (34%)
Similarity:171/312 - (54%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 KGKVVRQSII---NPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCKHVKGILLYGP 261
            |...:|:.:|   |..|.    .||| ..|.....::|....:...:..::||.|..:|||::||
  Fly   518 KPSAMREVLIECPNVQWS----DIGG-QSELRLAMQQAIEWPLLHADKFQRLGIKPPRGILMFGP 577

  Fly   262 PGTGKTLMARQIGTMLNAREPKI----VNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGL 322
            ||..||::|:.:.|     |.|:    :.||::...:|||||..||.:|.:|    :::.|    
  Fly   578 PGCSKTMIAKALAT-----ESKLNFLSIKGPELFSMWVGESERAVREVFRKA----RQVAP---- 629

  Fly   323 HIIIFDEIDAICKQR----GSVAGNSGVHDTVVNQLLTKIDGVDQLNNILVIGMTNRRDMIDEAL 383
            .|:.|||||||..:|    ||.:|:| |.:.|:.||||::|||:.|.|:.::..|||.||||:||
  Fly   630 AIVFFDEIDAIGGERSEGDGSSSGSS-VKERVLTQLLTELDGVEALQNVTIVAATNRPDMIDKAL 693

  Fly   384 LRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAA 448
            |||||::..:.:.||..:.|.:||.|..:.|    .|::|||.:::..||:.:||||::.:...|
  Fly   694 LRPGRIDRILYVGLPQCEARREILKIKLRAM----PISNDVDMEKLVQLTEGYSGAEIQAVCHEA 754

  Fly   449 QSSAMNRLIKA-DAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPAFGTAQEIL 499
            ...|:.:..:| |.|.|              ||.|:|: .:.|.  |:.|:|
  Fly   755 ALRALEQSFEAEDVKWT--------------DFEHALK-AVPPR--TSPELL 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 97/267 (36%)
AAA 256..397 CDD:278434 62/148 (42%)
AAA 539..668 CDD:278434
CG5776NP_001260420.1 SpoVK 288..785 CDD:223540 104/306 (34%)
AAA 307..447 CDD:278434
AAA 572..707 CDD:278434 62/148 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.