DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and Fign

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster


Alignment Length:509 Identity:125/509 - (24%)
Similarity:214/509 - (42%) Gaps:115/509 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TNRAIVNVGDFPEEIKYADISPAPGQHFIFALEKT-----------VEVPSGYVGFSLVQRKWAM 71
            |.|.|.:.| :..|:.:..:.....:.|..:.::|           :||.|.|            
  Fly    62 TKRGITHAG-YLFEMPHNSVFEPECRGFYESCQQTEMASSDLQAPALEVSSTY------------ 113

  Fly    72 VSINQELEVRPYRFDASSDVITCVSFETDFLQKKTVSQEPYDSDQMAKEFIMQFAGMALTVGQSL 136
             .:.|.::.||               |..|.:.:..|.:..|:.|.:.|...| :|......:..
  Fly   114 -PVQQAVKSRP---------------EGQFPESRNNSTKKIDAQQYSSESSSQ-SGFGFRTAREQ 161

  Fly   137 VFNFKDKKLLGLAVKSLEAID-------PKSLGEGKDTAMRNVRFGRILGNTVVQFEKAENSS-- 192
            :...:.||....|...::|:.       .|:|| ||.|...|      ..:.|.|.:.:.:|.  
  Fly   162 LIMDELKKKNRQATSEVDAVPTGMMNFRKKTLG-GKRTVSSN------FVSPVAQNDNSTSSRSS 219

  Fly   193 ------LNLQGKSKGKVVRQSIINPDWDFGKMG---IGGLDKEFNSIFRRAFASRVFPPELVEQL 248
                  .:|..|....::.:|:    .||..:.   |.||:.. .|.|..|....:..|:|...:
  Fly   220 SIPPALAHLDSKMVDHILGESM----HDFKPVAWEDIAGLESA-KSTFLEAIIMPLRRPDLFTGV 279

  Fly   249 GCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLFAEAEEEE 313
            .|. .:|:||:|||||||||:|:.|.:...|:...| |...:..|:||::|..|:.|||.|...:
  Fly   280 RCP-PRGVLLFGPPGTGKTLIAKSIASQAKAKFFSI-NPSSLTSKWVGDAEKLVKTLFAVAAAHQ 342

  Fly   314 KRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGV--DQLNNILVIGMTNRR 376
            ..        ||..||:|::..:|.:....|.:.  :.|:.|..:||.  ::...:||||.|||.
  Fly   343 PA--------IIFIDEVDSLLSKRSANENESTLR--LKNEFLIHLDGAASNEEIRVLVIGATNRP 397

  Fly   377 DMIDEALLRPGRLEVQMEISLPNEQGRVQILN--IHTKRMREFNKINDDVDNK---EIAALTKNF 436
            ..:|||:.|  |...::.:.||..:.|.:|:.  ||        ::..::|.:   |:|.||..:
  Fly   398 QELDEAVRR--RFVRRLYVPLPTREARQKIIEKLIH--------QVKHNLDVRQVIELAELTDGY 452

  Fly   437 SGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLK------VNRDDFLHSL 484
            |||:::.|.|.|..:.:..|         .|:.||.::      |..|||..:|
  Fly   453 SGADVDTLCRYASMAPLRSL---------TPDQMEVIETHQLPAVTMDDFKQAL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012 13/75 (17%)
CDC48_2 111..>158 CDD:215011 9/53 (17%)
SpoVK 242..699 CDD:223540 78/256 (30%)
AAA 256..397 CDD:278434 48/142 (34%)
AAA 539..668 CDD:278434
FignNP_001259995.1 AAA 282..418 CDD:214640 50/149 (34%)
AAA 286..416 CDD:278434 48/142 (34%)
Vps4_C <480..520 CDD:286426 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.