DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and CG31495

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001287320.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster


Alignment Length:347 Identity:134/347 - (38%)
Similarity:199/347 - (57%) Gaps:22/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 MEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAAQSSAMNRLI 457
            :.|:|||.:.||.:|.....|:.:.. :..||..:|||..||||:..||..|||.|...|:.|  
  Fly     2 VNITLPNTEERVNLLKSRINRLGDIT-VAGDVCAREIAMKTKNFTEDELCQLVREALHEAIVR-- 63

  Fly   458 KADAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPAFGTAQEILDNMLARGVINWGA-PVSNLLEDG 521
               ..||..|:.   |:|.:.|.|.::: .|:|.||..:|.|..::....::..| ..::||..|
  Fly    64 ---THVTRCPKG---LQVTQVDLLAAVK-IIQPRFGRQEETLQLLMPYEYLDRTAFDPNDLLSTG 121

  Fly   522 MLYVQQAKAPESSGLVSVLVAGAPNSGKTALAAQLAKMSDFPFVKVCSPEDMVGYTESAKCLHIR 586
                    .|..|   ..||.|.|.||.|.:|||:|..:|.||:|..|..:::|.::|.||..||
  Fly   122 --------RPRWS---CHLVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLGLSDSEKCQRIR 175

  Fly   587 KIFDDAYRSMLSCIVVDNVERLLDYGSIGPRYSNMTLQALLVLLKKQPPKGRKLLILCTSSRREV 651
            ::.:|||.|..||:::|:.||::.||::|.|||...||.|.||||||||...:|:|:|||:|.:|
  Fly   176 EVLEDAYVSRRSCVIIDDFERVIGYGALGKRYSKEFLQKLTVLLKKQPPNSHELIIICTSNRLDV 240

  Fly   652 LEEMEMLTAFTSVLHVPNLSKPDHVLAVLENTDIFSKGEIQAIGKKMAGKRVFIGIKKLLGLIDM 716
            |||:.:|:.||||.:|||:|.|..::.::|.:..|...|::.|...|.|:.|.||||:||.||..
  Fly   241 LEELGLLSVFTSVHNVPNVSTPKELMVIVEASKRFEPEELRQIEIAMDGRNVSIGIKRLLDLIAW 305

  Fly   717 ARQTEQSQRAIKFLSKMEEEGG 738
            .......:||.|.|.|:.|..|
  Fly   306 VNSLNPDRRAAKLLKKLGEAMG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 116/306 (38%)
AAA 256..397 CDD:278434 1/3 (33%)
AAA 539..668 CDD:278434 63/128 (49%)
CG31495NP_001287320.1 AAA 129..259 CDD:214640 65/129 (50%)
P-loop_NTPase 129..257 CDD:304359 63/127 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S525
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D197562at2759
OrthoFinder 1 1.000 - - FOG0003053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.