DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and figl-1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_504197.1 Gene:figl-1 / 178829 WormBaseID:WBGene00017981 Length:594 Species:Caenorhabditis elegans


Alignment Length:380 Identity:98/380 - (25%)
Similarity:160/380 - (42%) Gaps:98/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 KKLLGLAVKSLEAIDPKSLGEGKDTAMRNVRFGRIL---GNTVVQFEKAENSSLN---------- 194
            :|.:|:..:          |.|||..|..:|....|   ...::...::|..|:|          
 Worm   266 RKAMGMDTE----------GGGKDEKMSGLRAEPTLKHFDENIISLIESEIMSVNNEIGWADVAG 320

  Fly   195 LQGKSKGKVVRQSIINPDWDFGKMGIGGLDKEFNSIFRR--AFASRVFPPELVEQLGCKHVKGIL 257
            |:|..  |.:|:.::.|                   |:|  .|.....||           ||:|
 Worm   321 LEGAK--KALREIVVLP-------------------FKRPDVFTGIRAPP-----------KGVL 353

  Fly   258 LYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGL 322
            |:||||||||::.|.:.:...|....| :...:..|:|||.|..||.||:.|     ||...|  
 Worm   354 LFGPPGTGKTMIGRCVASQCKATFFNI-SASSLTSKWVGEGEKLVRALFSVA-----RLKLPS-- 410

  Fly   323 HIIIFDEIDAICKQRGSVAGNSGVHDT---VVNQLLTKIDGVDQL--NNILVIGMTNRRDMIDEA 382
             :|..||||::...|     :...|::   :..:.|.::|||:..  ..:||:|.|||...:|||
 Worm   411 -VIFIDEIDSLLSSR-----SESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEA 469

  Fly   383 LLRPGRLEVQMEISLPNEQGRVQI---LNIHTKRMREFNKINDDVDN---KEIAALTKNFSGAEL 441
            ..|  |.:.::.|:||..:.|.||   |.:.|:.         |:.|   :.|..||..:|||::
 Worm   470 ARR--RFQKRLYIALPEPESRTQIVQNLLVGTRH---------DITNHNLERIRELTDGYSGADM 523

  Fly   442 EGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPAFGTAQ 496
            ..|...|....:..:  .|...|:|.:.:..:.|.  ||..: ...::|....:|
 Worm   524 RQLCTEAAMGPIRDI--GDDIETIDKDDIRAVTVM--DFAEA-ARVVRPTVDDSQ 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 2/14 (14%)
SpoVK 242..699 CDD:223540 77/266 (29%)
AAA 256..397 CDD:278434 49/145 (34%)
AAA 539..668 CDD:278434
figl-1NP_504197.1 P-loop_NTPase 315..>371 CDD:304359 23/87 (26%)
AAA 348..484 CDD:214640 54/162 (33%)
AAA 352..480 CDD:278434 48/143 (34%)
Vps4_C <545..585 CDD:286426 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.