DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and Vcp

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_446316.1 Gene:Vcp / 116643 RGDID:621595 Length:806 Species:Rattus norvegicus


Alignment Length:619 Identity:176/619 - (28%)
Similarity:283/619 - (45%) Gaps:122/619 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 AMRNVRFGRIL----GNTVVQFEKAE-----------NSSLNLQGKSKGKVVRQSIINPDWDFGK 217
            |.|.:|.|.|.    |...|:|:..|           ::.::.:|:...:...:..:|   :.|.
  Rat   142 AYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLN---EVGY 203

  Fly   218 MGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREP 282
            ..|||..|:...| :......:..|.|.:.:|.|..:||||||||||||||:||.:     |.|.
  Rat   204 DDIGGCRKQLAQI-KEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAV-----ANET 262

  Fly   283 K----IVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGN 343
            .    ::|||:|:.|..||||:|:|:.|.|||:....        ||..||:|||..:|....|.
  Rat   263 GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA--------IIFIDELDAIAPKREKTHGE 319

  Fly   344 SGVHDTVVNQLLTKIDGVDQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILN 408
              |...:|:||||.:||:.|..:::|:..|||.:.||.||.|.||.:.:::|.:|:..||::||.
  Rat   320 --VERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQ 382

  Fly   409 IHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAAQSSAMNR---LIKADAKVTVDPEAM 470
            ||||.|    |:.||||.:::|..|....||:|..|...|...|:.:   ||..:.: |:|.|.|
  Rat   383 IHTKNM----KLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE-TIDAEVM 442

  Fly   471 EKLKVNRDDFLHSLEHDIKPAFGTAQEILDNMLARGVINW---GAPVSNLLEDGMLYVQQ----- 527
            ..|.|..|||..:|......|      :.:.::....:.|   |.     |||....:|:     
  Rat   443 NSLAVTMDDFRWALSQSNPSA------LRETVVEVPQVTWEDIGG-----LEDVKRELQELVQYP 496

  Fly   528 AKAPE---------SSGLVSVLVAGAPNSGKTALAAQLAKMSDFPFVKVCSPEDMV---GYTESA 580
            .:.|:         |.|   ||..|.|..|||.||..:|......|:.:..||.:.   |.:|: 
  Rat   497 VEHPDKFLKFGMTPSKG---VLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEA- 557

  Fly   581 KCLHIRKIFDDAYRSMLSCIV----VDNVER-----LLDYGSIGPRYSNMTLQALLVLLKKQPPK 636
               ::|:|||.| |....|::    :|::.:     :.|.|....|..|..|..:..:..|    
  Rat   558 ---NVREIFDKA-RQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTK---- 614

  Fly   637 GRKLLILCTSSRREVLEEMEMLTA-FTSVLHVPNLSKPDH------VLAVLENTDIFSKGEIQAI 694
             :.:.|:..::|.::::...:... ...::::|   .||.      :.|.|..:.:....:::.:
  Rat   615 -KNVFIIGATNRPDIIDPAILRPGRLDQLIYIP---LPDEKSRVAILKANLRKSPVAKDVDLEFL 675

  Fly   695 GKKMAGKRVFIGIKKLLGLIDMARQTEQSQRAIK 728
            .|...|   |.|          |..||..|||.|
  Rat   676 AKMTNG---FSG----------ADLTEICQRACK 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 149/499 (30%)
AAA 256..397 CDD:278434 62/144 (43%)
AAA 539..668 CDD:278434 31/141 (22%)
VcpNP_446316.1 CDC48 25..764 CDD:273521 176/619 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000250 797..806
PIM motif. /evidence=ECO:0000250|UniProtKB:P55072 802..806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.