DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NDUFB3 and ND-B12

DIOPT Version :9

Sequence 1:NP_001244031.1 Gene:NDUFB3 / 4709 HGNCID:7698 Length:98 Species:Homo sapiens
Sequence 2:NP_001097399.1 Gene:ND-B12 / 37466 FlyBaseID:FBgn0034645 Length:110 Species:Drosophila melanogaster


Alignment Length:109 Identity:38/109 - (34%)
Similarity:50/109 - (45%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    10 GHH--KMELPDYRQWKIEGTP-LETIQKKLAAKGLRDPWGRNEAWRY-MGGFAKSVSFSDVF-FK 69
            |||  ...:|....:|:|..| |..:::.|..:||:|||.|||.||| ...|....|..:.| |:
  Fly     3 GHHGEPYTVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYEPKAFGTHRSRLNTFLFR 67

Human    70 GFKWGFAAFVVAVGAEYYLESLNK---------------DKKHH 98
            |...||.||:..|..||.| .:.|               ||.||
  Fly    68 GLGVGFCAFLATVAVEYAL-GIGKGQGGHGHGHGHEEHGDKGHH 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NDUFB3NP_001244031.1 NDUF_B12 42..97 CDD:400443 25/71 (35%)
ND-B12NP_001097399.1 NDUF_B12 38..86 CDD:400443 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158096
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5447
Isobase 1 0.950 - 0 Normalized mean entropy S6959
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1568057at2759
OrthoFinder 1 1.000 - - FOG0006542
OrthoInspector 1 1.000 - - oto90518
orthoMCL 1 0.900 - - OOG6_109209
Panther 1 1.100 - - LDO PTHR15082
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5815
SonicParanoid 1 1.000 - - X4780
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.