DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and CG42526

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:253 Identity:52/253 - (20%)
Similarity:103/253 - (40%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMK-- 74
            ||..||.:||.|..|:::.|..|.    :.|.|..:|:......:.|..|||||||::.||.:  
  Fly     4 FDALLIASVKRNVSIFEKYHTRYD----RKQAWIAVAQACQKSVEYCQIRWKSLRDRYVRETQKP 64

  Fly    75 LCQESRWRYFKQMQFLVDSIRQYR------------ESLLGKCANGSQSANQVADPSQQQQAQQQ 127
            ....|..|.||::.||.:.||..|            ::|:......||||:::|   .::....:
  Fly    65 AATRSNIRKFKELDFLREHIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELA---LERNGITE 126

  Fly   128 TVVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKD-------QKPYFYEPPLKRERSE 185
            ...|.|...:.|.           .|....:|...|..:.:|       :.||..:|....| .:
  Fly   127 FQPDEFIIEYKGE-----------EEYLSETDNSSAEFISEDSACNIGSELPYVTKPSFNGE-GQ 179

  Fly   186 EEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTD 243
            .:.....::.:.:.::.:....:.....|...:..:|..:....:.:.::.::.:::|
  Fly   180 SQTQAKFMSVMNLIESALKDKPAEPQDPFYKYLESILTGVDDSTRIDIQLKVLNFVSD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 27/81 (33%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.