DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and CG11504

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:254 Identity:51/254 - (20%)
Similarity:95/254 - (37%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLG--VPEQKCTKRWKSLRDKFAREM--- 73
            |.||...:....::|.:...|:....|.:...::::.||  :|..:..|::.:||.::.||:   
  Fly     9 LQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREISRM 73

  Fly    74 --KLCQESRWRYFKQMQFLVDSIR------QYRESLLG---KCANGSQSANQVADPSQQQQAQQQ 127
              |....|:|..||.:.||.....      :.:..|.|   |...|..:|:..:|.|........
  Fly    74 KRKEPYNSKWFGFKNLVFLSSPYACRSTKGRLKADLQGDERKFVLGEVTADHNSDSSTPANHNSN 138

  Fly   128 TVVDIFAQPF-NGSATTSAQALTHPHEITV----------TSDAQLATAVGKDQKPYFYEPPLKR 181
            |..::..:.. ...|::.||.|....|.|.          ..:.::.....|:....|..   ..
  Fly   139 TNANMNEEYLRKNHASSRAQELEKLIEETTKDVDDIDESELEEGEVKPKQAKEMSVRFVS---LN 200

  Fly   182 ERSEEEHSDNMLNTIKIF--QNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHII 238
            |:.|.|..:|...|:...  |.|..:|||.:....|.:   ...|...:....:.||::
  Fly   201 EQEETEPLENHHQTLMDLHHQGNAVEAVSFQANESGEL---HYQTTPTQSTGSSSVHVM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 20/86 (23%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 18/80 (23%)
CytochromB561_N 238..>409 CDD:286826 3/22 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.