DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and hng2

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:261 Identity:55/261 - (21%)
Similarity:104/261 - (39%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETL-------GVPEQK-----CTKRWKSLRDKF 69
            |:||....:|::|||.|:.:...:.:.|:||...|       ..||::     ..||||:.||.:
  Fly    22 IDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDSY 86

  Fly    70 AREMKLCQ------ESRWRYFKQMQFLV-------DSIRQYRE--SLLGKCANGSQSANQVADPS 119
            .|..:|.|      .:.:.|.|::.||:       |.:...:|  ....|....|.:|.:.|...
  Fly    87 LRVNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLKEQPKPQAKRKRVSTAAQRSAKTP 151

  Fly   120 QQQQAQQQTVVDIFAQPFNGSATTSAQALTHP----HEITVTSDAQLATAVGKDQKPYF-YEPPL 179
            :::.:.|::.::              .|:.:|    :..||..|  |..|......|.. |.|.|
  Fly   152 RKRNSDQESNIE--------------PAIRNPAIPSNINTVLGD--LGCAKEDTATPEIAYIPQL 200

  Fly   180 KRERSEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDM 244
            .        ||...:|      |.:...:..||:|...:...:..:...:|.:.::.::|.|.:.
  Fly   201 P--------SDPPCST------NTAYLSADPDQAFFDTIKPHMQQMCADRKLDFQIEVLKILRNF 251

  Fly   245 Q 245
            :
  Fly   252 K 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 28/102 (27%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 25/90 (28%)
BESS 216..250 CDD:281011 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.