DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and Mes2

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 / 40514 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster


Alignment Length:182 Identity:44/182 - (24%)
Similarity:75/182 - (41%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LNLIEAVKLNPVIYDRSHYNYKHF-VRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREM---K 74
            |.||:.|..||:::|....|:|.. ..|.:.|:.|......|.::..:.:||||:.:.||:   |
  Fly    61 LKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRRELAHVK 125

  Fly    75 LCQ---ESRWRYFKQMQFLVDSIRQYRE---------SLLGKCANGSQSANQVADPSQQQQAQQQ 127
            |..   :.:|..::.|.||.|.||:.:.         :..|...|.:.:.|.    |....|..:
  Fly   126 LMGNGFKPKWSLYEAMDFLRDVIRERKGASHATDLSLTTYGHINNNNNNNNN----SNSLAAGGK 186

  Fly   128 TVVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPL 179
            .:....:..||.||  |...|:....:.|:.|....        .|:.:|.|
  Fly   187 AMTLKLSNSFNESA--SVLNLSKCSSLNVSDDHYYC--------DYYVKPEL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 25/86 (29%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.