DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and CG9948

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:94/252 - (37%) Gaps:62/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FDLNLIEAVKLNPVIYDRSHY-NYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKL 75
            ||..||:.|:.|||:|.||.. ||.....|...|.:|||.:|.....|..||.:|..:|.:|.:.
  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75

  Fly    76 CQE--SRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQ--------QQQAQQQTVV 130
            ...  |.|.|.::::||.                      ::..||:        :|:|..||  
  Fly    76 ADTSGSTWPYLERLRFLA----------------------EIQPPSKVKTKPKTNKQEATIQT-- 116

  Fly   131 DIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNT 195
                       .|..|.|....|     |..    |.:....:..|..:      ||.|:.::..
  Fly   117 -----------ETPVQFLWDTFE-----DGD----VPQQSSTFIIEEVI------EEPSEQIIQE 155

  Fly   196 IKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNK 252
            ..|::......:.:...|| :.:..:|..|...|:..|:..|..:|...||.|..|:
  Fly   156 EIIYEEQEPAEIISPRSSF-LQMDQILAQLKEPQRRRAERRITAFLLKCQLRALSNQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 28/82 (34%)
CG9948NP_001261492.1 MADF 14..95 CDD:214738 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.