DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and hng3

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster


Alignment Length:297 Identity:55/297 - (18%)
Similarity:111/297 - (37%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLC---- 76
            ||..|:....::|..|.::.:.....:.|..:||..|:..:.|..:||:||..:.|..:..    
  Fly     6 LIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGILK 70

  Fly    77 -QES-----RWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIF-- 133
             |:|     :|.|.:.|.|| |..|:       :|.| |.:..:..:.:.:.:|:...::..|  
  Fly    71 HQQSPSPGHQWSYAEAMSFL-DGQRE-------ECDN-SNNGEEEMESALKIEAEHMPMLSTFKS 126

  Fly   134 --------AQPFNGSATTSAQALTHPHEI-TVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHS 189
                    .:..|.:.....|.::.|..: .::.:..||:|..::|.|          .:.::.|
  Fly   127 EQVSAADEMEADNDALMREFQNVSTPQALRRLSENISLASAAAEEQVP----------STADQLS 181

  Fly   190 DNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKV------------------- 235
            .| ||     |.:...|.:|........|.:.:|.|...::.|.::                   
  Fly   182 PN-LN-----QGSAIAAAAASSCHCAKRVDEQVNFLESLEREEQQLMQSTSQDLARCKSVLHVGD 240

  Fly   236 ----HIIKYLTDMQLLAQHNKYXLSGGCHRQLLQLLQ 268
                ::|.:|..|:.:...... ........|||.:|
  Fly   241 SDYNYLISFLPLMKQMTPFQNVFFRAKMGELLLQTMQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 23/88 (26%)
hng3NP_612057.1 MADF 5..91 CDD:214738 22/85 (26%)
BESS 240..274 CDD:281011 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D98646at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.