DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and brwl

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster


Alignment Length:349 Identity:63/349 - (18%)
Similarity:119/349 - (34%) Gaps:125/349 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREM 73
            ::.|::..:..|:.:..:||:....|::...:.:.|..|::........|.:||::||...:|.:
  Fly    54 DEDFNIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYI 118

  Fly    74 KL-----CQESRWRYFKQMQFLVDSIRQYRESLLGK----------------------------- 104
            |.     .|...:...:.|.||:..::..|.||.|.                             
  Fly   119 KQQSGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPFLLHPALHATE 183

  Fly   105 ----CANGS----QSANQVADPSQQQ---------QAQQQTVVDIF--------------AQPFN 138
                |||.|    .:.|.|.:....:         :...:..:|.|              :.|..
  Fly   184 EHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETIDAFDPAVTNTLGMNRTSSTPTR 248

  Fly   139 GSA-------------TTSAQAL----------------------------------THPHEITV 156
            .||             |.||.::                                  :|||.:|:
  Fly   249 SSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPPLHYHPHSHPHPLTL 313

  Fly   157 TSDAQLATAVGKDQKPYFYEP-PLKRERSEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTD 220
            :          .|..|..||| ..||.::|.|.:..|.|...|: ..:|.:..|:.:.|..::.|
  Fly   314 S----------MDHHPASYEPGSTKRIKTECEATSTMTNAGSIY-GGLSSSEVADMEFFRSILPD 367

  Fly   221 MLNTLGVRQKAEAKVHIIKYLTDM 244
             |.||..:|:.:.|:.|::.:.|:
  Fly   368 -LATLTPQQRRKFKIGILELIDDV 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 17/84 (20%)
brwlNP_609298.1 MADF 60..145 CDD:214738 17/84 (20%)
BESS 356..389 CDD:281011 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.