DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and CG8119

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:261 Identity:52/261 - (19%)
Similarity:101/261 - (38%) Gaps:51/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQ---TWKQIAETLGVPEQKCTKRWKSLRDK 68
            |||..   :|:..:.|.|.|:|.   ..|..:|:.|   .|..::..:|:...:|.:||||||:.
  Fly    12 NLETN---HLLREIALRPSIWDS---RIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNN 70

  Fly    69 FAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIF 133
            :..::.......|.:.|||:|:.|....::.....:|....:.:..:..|.|..|:     |..:
  Fly    71 YRTKIHQGNAWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKKSKLILHPQQYLQS-----VASY 130

  Fly   134 AQPFNGSATTSAQ----ALTHPHEITVTSDAQLATAVGKDQ-----------KPYFYEPPLKRER 183
            :....|.....|:    .:|......:..|.::...:|.||           .|.|..||     
  Fly   131 SAFKKGGIEFEAEERLFLVTDEPAFDLDVDEEVTRLLGTDQWLWQTNLDFILLPIFRAPP----- 190

  Fly   184 SEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLA 248
                            .:.:::..:..::.|.:.:..||.:|..|.|...:....:.|.:| |:|
  Fly   191 ----------------PSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRRVLREM-LIA 238

  Fly   249 Q 249
            :
  Fly   239 E 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 23/82 (28%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/82 (28%)
BESS 201..234 CDD:281011 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.