DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and Hmr

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_572637.2 Gene:Hmr / 31988 FlyBaseID:FBgn0001206 Length:1413 Species:Drosophila melanogaster


Alignment Length:292 Identity:61/292 - (20%)
Similarity:107/292 - (36%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQE-- 78
            ||..|:..|::||..|..::...::.:.||:||..|......|.:.|.:||.|:.|.::..:.  
  Fly    59 LIALVRRQPLLYDARHPKFRDVAQREKQWKKIASRLATNATNCKRSWSALRYKYQRHVRRLRNFH 123

  Fly    79 ----------SRWR----YFKQMQFLVDSIRQY--------RESLLGKCANGSQSANQV------ 115
                      .|||    |.::|:|:...:.::        .|.|..:..:.|::...|      
  Fly   124 RSAIQKDRAALRWRPCMEYEEEMRFMYTHVARFPLIVDKIPTEILEKEHVDESETRPDVEVIENP 188

  Fly   116 ----------ADPSQQ---QQAQQQTVVDIFAQPFNGSATTSAQALTHPHEITVTS--------- 158
                      .||:..   .:.|::.:..:.|.|....:|.:....|. |...:.|         
  Fly   189 PMDIIDLDVEEDPTYNYRCNRLQRRLIEAVSAYPLLYDSTCTGYQNTR-HRFLIWSAISNEVHDK 252

  Fly   159 DAQLATAVGKDQKPYFYEPPLKRER----SE--------EEHSDNMLNTI----KIFQNNVSQAV 207
            ..:|.....|.|..|.:| .:.|.|    ||        |.|...|..|:    |..||...:.:
  Fly   253 ATKLMKCWLKLQTRYEWE-LIHRPRHIGTSELCRLMDFMEPHVQRMRGTVCKSSKYLQNGWHEPI 316

  Fly   208 SAEDQSFGMV---VTDMLNTLGVRQKAEAKVH 236
                ::|..|   :|.|.|...:.|..|..:|
  Fly   317 ----ENFHTVMALITTMRNMPELVQLTEDSLH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 24/94 (26%)
HmrNP_572637.2 MADF_DNA_bdg 59..149 CDD:287510 23/89 (26%)
GT1 213..295 CDD:304916 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.