DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and madf-3

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:89 Identity:29/89 - (32%)
Similarity:51/89 - (57%) Gaps:6/89 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGV--PEQKCTKRWKSLRDKFA 70
            :|..|:|.|||||:.:..::|.:...|::...|.:.|:::...||.  ..:..:.|||.||||:.
 Worm     2 IEPTFNLRLIEAVRHSRCLFDNTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYG 66

  Fly    71 REMKL----CQESRWRYFKQMQFL 90
            :|.:.    .::|.|:|||.:.||
 Worm    67 KEKRKQKYGNEKSSWQYFKHLHFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 26/82 (32%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 26/82 (32%)
MADF 122..212 CDD:214738
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7669
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.