DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and madf-8

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_497739.1 Gene:madf-8 / 183517 WormBaseID:WBGene00008118 Length:300 Species:Caenorhabditis elegans


Alignment Length:216 Identity:47/216 - (21%)
Similarity:79/216 - (36%) Gaps:56/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLD-ANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKR----W 62
            |:| |..|:.:|  :|.||:..|:::|:....:::.....:.|.|:...||:.|:....|    |
 Worm   124 KIDYAEPEKVYD--IIYAVRKRPILWDQRLICHRNSNLSRRAWDQLDLELGIDEEYPLARRKQIW 186

  Fly    63 KSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQ 127
            ||.||.|...:......:|.|...::|....| .:|.:.   |...:     ||.|||.      
 Worm   187 KSKRDYFVSAVNAANLRKWIYADALEFYRPMI-NFRTTF---CLRPT-----VAQPSQS------ 236

  Fly   128 TVVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQK-------PYFYEPPLKRERSE 185
                                   .|:..|.:|..:....| |:|       ...|:..:......
 Worm   237 -----------------------VHDKLVLADKNIQCTPG-DKKNVLTFLLKSLYDTGMSSPEMM 277

  Fly   186 EEHSDNMLNTIKIFQNNVSQA 206
            .||.   |..:|||:.|...:
 Worm   278 AEHG---LEILKIFKKNAESS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 20/83 (24%)
madf-8NP_497739.1 MADF 135..219 CDD:214738 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.