DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and madf-4

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:332 Identity:70/332 - (21%)
Similarity:126/332 - (37%) Gaps:108/332 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVR--KAQTWKQIAETLGVPEQ--KCTKRWKSLRDK 68
            ||..|.|.||::|:.||.:|:|  |:..|.|.  |.:.||.|:..:|...|  :..::||.:|||
 Worm    14 LEDDFTLALIDSVQRNPCVYNR--YDPLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDK 76

  Fly    69 FAREMK-------LCQESRW-RYFKQMQFLVDSIRQYR--------------------------- 98
            :.|..|       :.:.::| .|:.:|.|| |...::|                           
 Worm    77 YVRLRKQDKQKAPIKKTNKWYNYYHKMSFL-DPYVEHRNRKRQKDYLNSNTPDFLDDDTAFLDGL 140

  Fly    99 --------ESLL--------------GKCANGSQSANQVAD-PS---QQQQAQQQTVVDIFAQPF 137
                    ||||              ...::||.:..:..| |:   :..:.....:.|.|..  
 Worm   141 SVKEMLKPESLLTSNDAGYNSPHTTSSSSSSGSNNNGRFLDSPTIDIEDDKKNLALIYDKFVA-- 203

  Fly   138 NGSATTSAQALTHPH------EITVTSDAQLAT-----AVGKDQKPYFYE-----PPLKRERSEE 186
            |.:........::.|      ..|.|...:|||     :..:.:||...:     ||.:.:.::.
 Worm   204 NQTENEKNHRFSNKHGKDLLFSTTNTLIEKLATTSTAPSSSRKRKPIPVQILPSSPPPQEKNTKI 268

  Fly   187 EHSDNMLN-----TIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQL 246
            |..:::||     .:.:|..::::.               ||.|...:.|.|:|.|.|.|..::.
 Worm   269 ELLEDILNEPNEDQVSLFVRSIART---------------LNDLDREKFAMARVEISKVLYKIEF 318

  Fly   247 LAQHNKY 253
              ..|:|
 Worm   319 --GDNQY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 29/91 (32%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7669
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29029
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.