DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and LOC110439798

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:257 Identity:58/257 - (22%)
Similarity:104/257 - (40%) Gaps:62/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESR 80
            |:.||...|::::|...:|:...|:.:.|:.:|.::|:...:|.:|||::||::.||.:||:..:
Zfish    32 LLRAVYRIPLLHNRLRTDYRSTERRERVWRDVAASIGLSVVECKRRWKTIRDRYIRERRLCKLKK 96

  Fly    81 ---------WRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQ------------- 123
                     |.:.:.:.||...||:.|.      .:|:|.      |.::||             
Zfish    97 DLGGRRLHYWPHRESLAFLDAHIRKRRR------PSGAQG------PEEEQQEEHSSAALQEDKE 149

  Fly   124 --AQQQTVVDI--FAQPFNG---SATTSAQALTHPHEITVTS-DAQLATAVGKDQKPYFYEP--- 177
              .|::.|.|.  |..|.|.   |..|..:.:.....:.:|| ...|..|......|.....   
Zfish   150 ECVQEECVSDSSRFVSPLNPLPLSIVTQLKPVPQVSPLLLTSLPPGLKVAPASSSAPPLLPASAS 214

  Fly   178 --PLKRERSEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHI 237
              ||.....|::.:|..|:               |||.|.:.....|..|..:::|..|:.|
Zfish   215 AGPLNVPLEEQQRADGALD---------------EDQLFLLSYVPALKRLTPQKRAAVKMQI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 23/87 (26%)
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 23/87 (26%)
BESS 233..267 CDD:308542 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.