DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adf1 and LOC100330838

DIOPT Version :9

Sequence 1:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:136 Identity:38/136 - (27%)
Similarity:63/136 - (46%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESR 80
            ||.||...|.:|:.:..:||...|||:.|:.::..:.:||:.|.:|||||||.|.::.:..|..|
Zfish     9 LIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQRRR 73

  Fly    81 --------WRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVD----IF 133
                    |:|..||.||...|:           :.|.:|::..:....:...::...|    ..
Zfish    74 ASGTSHRSWKYSWQMSFLTPFIQ-----------SRSLAADEPEEDRDDEDKDEERTADGNSAFV 127

  Fly   134 AQPFNG 139
            .|.|.|
Zfish   128 VQDFEG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adf1NP_001260730.1 MADF 15..95 CDD:214738 31/86 (36%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 31/86 (36%)
BESS 167..200 CDD:397204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10337
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.