DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and YOX1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:67/291 - (23%)
Similarity:106/291 - (36%) Gaps:101/291 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 MLDPTGSMTTLAPISESPLTPTHQHLHGSYH----------SMNHMMSHHHPGTLSGHTGGHHGH 202
            ||....|:.:...||.||::|:..:...|:|          .:|  .|.:.|.::         .
Yeast     7 MLPSLSSLLSGTEISSSPVSPSFTNPRTSFHLDDRGTIKLPPLN--TSINRPRSV---------E 60

  Fly   203 SAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALS 267
            ||:.|.|       ..||.::       .|:.:..      |..||:|             .|||
Yeast    61 SALRHTV-------TSLHENS-------SAYGDDM------LKHTQSD-------------SALS 92

  Fly   268 QSTICRFESLTLSHNNMI-------------------ALKPILQAWLEEAEAQAKNKRR------ 307
            .......|::..||.|::                   .|.|:..|......:.:|.|||      
Yeast    93 SQLNSSQETVDESHENLLLTPLNSKKRDYSVSSKKNDILTPLSAAKSIIIPSASKEKRRAFAFIT 157

  Fly   308 ---------DPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNV 363
                     :|...:. |...:||:|||  :.|...|:|.|...|.||.||...:||...:.:..
Yeast   158 HSQETFPKKEPKIDNA-PLARRKRRRTS--SQELSILQAEFEKCPAPSKEKRIELAESCHMTEKA 219

  Fly   364 VRVWFCNQRQKQKR----------IVSSVTP 384
            |::||.|:||..||          |:.:|:|
Yeast   220 VQIWFQNKRQAVKRQRIATSKSTTIIQTVSP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 15/95 (16%)
Homeobox 323..377 CDD:395001 20/53 (38%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1861
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.