DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Pou5f2

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_083591.1 Gene:Pou5f2 / 75507 MGIID:1922757 Length:329 Species:Mus musculus


Alignment Length:163 Identity:63/163 - (38%)
Similarity:92/163 - (56%) Gaps:22/163 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGA-----LSQSTICRFESLT 278
            |..|.....:|:|..|:..:|:|:.||.:|||||.|        |||     |||:||||||:..
Mouse   104 LPEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFA--------VGAMFGKVLSQTTICRFEAQQ 160

  Fly   279 LSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKR---SLEAYFA 340
            ||..||..|:|:|:.||||.:  .||.........:|....|:|:    |:.|:|   :||..|.
Mouse   161 LSLANMWKLRPLLKMWLEEVD--EKNLLGICRMEMILEQARKRRR----ASRERRIGSNLEKLFL 219

  Fly   341 VQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQ 373
            ..|.|:.::|:.||.:|.|:|::|:|||.|:.|
Mouse   220 QCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 37/81 (46%)
Homeobox 323..377 CDD:395001 20/54 (37%)
Pou5f2NP_083591.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pou 113..181 CDD:278582 36/75 (48%)
Homeobox <214..250 CDD:278475 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847031
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.