DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Pou5f2

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001075220.2 Gene:Pou5f2 / 680620 RGDID:1589456 Length:335 Species:Rattus norvegicus


Alignment Length:163 Identity:63/163 - (38%)
Similarity:92/163 - (56%) Gaps:22/163 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGA-----LSQSTICRFESLT 278
            |..|.....:|:|..|:..:|:|:.||.:|||||.|        |||     |||:||||||:..
  Rat   110 LPEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFA--------VGAMFGKVLSQTTICRFEAQQ 166

  Fly   279 LSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKR---SLEAYFA 340
            ||..||..|:|:|:.||||.:  .||.........:|....|:|:    |:.|:|   :||..|.
  Rat   167 LSLANMWKLRPLLKMWLEEVD--EKNLLGICRMEMILQQARKRRR----ASRERRIGSNLEKLFL 225

  Fly   341 VQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQ 373
            ..|.|:.::|:.||.:|.|:|::|:|||.|:.|
  Rat   226 QCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 37/81 (46%)
Homeobox 323..377 CDD:395001 20/54 (37%)
Pou5f2NP_001075220.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pou 119..187 CDD:395105 36/75 (48%)
homeodomain <220..256 CDD:412151 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.