DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Gm9376

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001095079.1 Gene:Gm9376 / 668814 MGIID:3643023 Length:176 Species:Mus musculus


Alignment Length:159 Identity:39/159 - (24%)
Similarity:63/159 - (39%) Gaps:49/159 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNN 283
            :.|:|..||.:|      ...||       :|.||    ||               |...:|.:.
Mouse     1 MKPETGEDPGKL------CTHRR-------SDNGK----LK---------------EGTQVSSSL 33

  Fly   284 MIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGE 348
            |          :||.:......|. .|:.:||.:      :|.:...:.:.|..:|.....|:.|
Mouse    34 M----------MEEIDRMIVQMRL-KDSKTVLIS------KTELTDVQFQKLRKHFETDCYPNEE 81

  Fly   349 KIAAIAEKLDLKKNVVRVWFCNQRQKQKR 377
            .:.|.||:|.|:|:|:|.||..||::..|
Mouse    82 TLQAFAEELKLQKDVIRSWFITQRRRMMR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 16/76 (21%)
Homeobox 323..377 CDD:395001 17/53 (32%)
Gm9376NP_001095079.1 HOX 56..108 CDD:197696 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.