DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and POU5F1

DIOPT Version :10

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_002692.2 Gene:POU5F1 / 5460 HGNCID:9221 Length:360 Species:Homo sapiens


Alignment Length:165 Identity:77/165 - (46%)
Similarity:106/165 - (64%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 HPDTDTD----PRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGV---GALSQSTICRFESL 277
            :|:...|    .:|||.||:..||:||.||.||||||..|      ||   ...||:||||||:|
Human   132 NPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTL------GVLFGKVFSQTTICRFEAL 190

  Fly   278 TLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQ 342
            .||..||..|:|:||.|:|||: ..:|.:....|.:::.|  :|||||||....:.:||..|...
Human   191 QLSFKNMCKLRPLLQKWVEEAD-NNENLQEICKAETLVQA--RKRKRTSIENRVRGNLENLFLQC 252

  Fly   343 PRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKR 377
            |:|:.::|:.||::|.|:|:||||||||:|||.||
Human   253 PKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 41/83 (49%)
Homeodomain 321..377 CDD:459649 29/55 (53%)
POU5F1NP_002692.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
9aaTAD. /evidence=ECO:0000269|PubMed:34342803 4..12
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..114
POU 138..212 CDD:197673 41/79 (52%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:P20263 180..186 4/5 (80%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:P20263 193..196 1/2 (50%)
Homeodomain 231..287 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.