DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and CCHCR1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001381570.1 Gene:CCHCR1 / 54535 HGNCID:13930 Length:880 Species:Homo sapiens


Alignment Length:487 Identity:85/487 - (17%)
Similarity:161/487 - (33%) Gaps:168/487 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCDSLESRLLEDASLLCNSWS 68
            |:::|.:.:::...|.   .:..:.:..|..|:..|:         ||||.........|.|.| 
Human   384 SLHATAELLQVRVQSL---THILALQEEELTRKVQPS---------DSLEPEFTRKCQSLLNRW- 435

  Fly    69 ARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPP------Q 127
                              .|.:.|:.:|....:..||....|:|..|......::...      |
Human   436 ------------------REKVFALMVQLKAQELEHSDSVKQLKGQVASLQEKVTSQSQEQAILQ 482

  Fly   128 RPLQENP--------------------------FSRQMHHSMDQLDMLDPTGSM------TTLAP 160
            |.||:..                          :.:|...:.:||.::....|.      ||:|.
Human   483 RSLQDKAAEVEVERMGAKGLQLELSRAQEARRRWQQQTASAEEQLRLVVNAVSSSQIWLETTMAK 547

  Fly   161 ISESPLTPTHQHLHGSYHSMNHMMSH-----HHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLH 220
            :..:.         ....|:|:.:|:     |   |:.|              :|...:|.|.|.
Human   548 VEGAA---------AQLPSLNNRLSYAVRKVH---TIRG--------------LIARKLALAQLR 586

  Fly   221 --------PDTDTDPRELEAFAERFKQRRIKLGVT----QADVGKA------------------- 254
                    |.||.. .||:...|...:...:|.::    |.:||:|                   
Human   587 QESCPLPPPVTDVS-LELQQLREERNRLDAELQLSARLIQQEVGRAREQGEAERQQLSKVAQQLE 650

  Fly   255 ---------LANLKL------PGVGALSQSTICRFESLTLS--------HNNMIALKPILQAWLE 296
                     ||:|.|      .|....::......:.||..        ...:..::..|:..|.
Human   651 QELQQTQESLASLGLQLEVARQGQQESTEEAASLRQELTQQQELYGQALQEKVAEVETRLREQLS 715

  Fly   297 EAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQP---RPSGEKIAAIAEKLD 358
            :.|.:....||: .|.:|:...:.:|:    ||.||...:....:|.   :..|:::|...::|:
Human   716 DTERRLNEARRE-HAKAVVSLRQIQRR----AAQEKERSQELRRLQEEARKEEGQRLARRLQELE 775

  Fly   359 LKKNVVRVWFCNQ----RQKQKRIVSSVTPSM 386
            ..||::......:    |.||:|:: :|.||:
Human   776 RDKNLMLATLQQEGLLSRYKQQRLL-TVLPSL 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 19/122 (16%)
Homeobox 323..377 CDD:395001 13/60 (22%)
CCHCR1NP_001381570.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.