DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and POU3F1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_002690.3 Gene:POU3F1 / 5453 HGNCID:9214 Length:451 Species:Homo sapiens


Alignment Length:259 Identity:104/259 - (40%)
Similarity:139/259 - (53%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHS 203
            :||::.:      .|....|.|   ||  |.|...||  |:..|           .|.||.|..:
Human   187 LHHALHE------DGHEAQLEP---SP--PPHLGAHG--HAHGH-----------AHAGGLHAAA 227

  Fly   204 AVHHPVITAAVAAAGLHPDTDT-DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALS 267
            |..||......::.|.|.|.|. ...:||.||::|||||||||.||||||.||..|.   ....|
Human   228 AHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLY---GNVFS 289

  Fly   268 QSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEK 332
            |:||||||:|.||..||..|||:|..||||.::.:.:   ..:...:...|.|::|||||....|
Human   290 QTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGS---PTNLDKIAAQGRKRKKRTSIEVGVK 351

  Fly   333 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY 396
            .:||::|...|:||..:|..:|:.|.|:|.||||||||:|||:||    :||      :||.|:
Human   352 GALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKR----MTP------AAGAGH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 45/77 (58%)
Homeobox 323..377 CDD:395001 28/53 (53%)
POU3F1NP_002690.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..154
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..253 24/89 (27%)
POU 247..321 CDD:197673 44/76 (58%)
Homeobox 342..396 CDD:395001 28/53 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 395..451 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.