DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and POU1F1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001116229.1 Gene:POU1F1 / 5449 HGNCID:9210 Length:317 Species:Homo sapiens


Alignment Length:292 Identity:104/292 - (35%)
Similarity:145/292 - (49%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MHHSMDQLDMLD--PTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGH-- 199
            ||||..:...:.  .|..|:|:..|.....||.....|.|..::.:..:..|....|.|.|..  
Human    27 MHHSAAECLPVSNHATNVMSTVPSILSLIQTPKCLCTHFSVTTLGNTATGLHYSVPSCHYGNQPS 91

  Fly   200 ----------------------HGHSAVHHPVITAAVAAAGLHP-------------DTDT-DPR 228
                                  ||...:|.|::.....||....             |.|: :.|
Human    92 TYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIR 156

  Fly   229 ELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGA-LSQSTICRFESLTLSHNNMIALKPILQ 292
            |||.||..||.||||||.||.:||:|||.:.    |: .||:||||||:|.||..|...||.||.
Human   157 ELEKFANEFKVRRIKLGYTQTNVGEALAAVH----GSEFSQTTICRFENLQLSFKNACKLKAILS 217

  Fly   293 AWLEEAE--AQAKNKRRDPDAPSVLPAGEKKRK-RTSIAAPEKRSLEAYFAVQPRPSGEKIAAIA 354
            .||||||  ....|::        :.|.|:||| ||:|:...|.:||.:|..|.:||.::|..:|
Human   218 KWLEEAEQVGALYNEK--------VGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMA 274

  Fly   355 EKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSM 386
            |:|:|:|.||||||||:||::||:.:|:..|:
Human   275 EELNLEKEVVRVWFCNRRQREKRVKTSLNQSL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 44/78 (56%)
Homeobox 323..377 CDD:395001 27/54 (50%)
POU1F1NP_001116229.1 POU 150..224 CDD:197673 43/77 (56%)
Homeobox 243..297 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.