DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and pdm2

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:416 Identity:129/416 - (31%)
Similarity:184/416 - (44%) Gaps:111/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCDSLESRLLEDASLLCN 65
            :.:.::|..:.::..||..|                  |||:              |....||.|
  Fly   541 LQLQLHSYIEMVRQLAPEAF------------------PNPN--------------LATQFLLQN 573

  Fly    66 SWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGP-PQRP 129
            |..|              |::.:||              .||..|.:.|.:   .|.|.| .:.|
  Fly   574 SLQA--------------LAQFQAL--------------QQMKQQQREDPL---PSYSTPLAKSP 607

  Fly   130 LQENPFSRQMHHSMDQLDMLDPTGSMTT----LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPG 190
            |:....|....||..|  ...|..|||.    ::....:|.||:.|        ....:....|.
  Fly   608 LRSPSLSPVPRHSKSQ--QRTPPNSMTANSLGMSSAVMTPNTPSMQ--------QQPQLQQSTPK 662

  Fly   191 TLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKAL 255
            ..||.|             :.:|:|.....|:..||..|||.||:.|||||||||.||.|||.|:
  Fly   663 PTSGLT-------------VASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAM 714

  Fly   256 ANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQ-AKN-----------KRRD 308
            .  ||.| ...||:||.|||:|.||..||..|||:||.|||:|::. ||:           ....
  Fly   715 G--KLYG-NDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLS 776

  Fly   309 PDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQ 373
            ....|:|  |.:::|||||....:.:||..|.:..:|:.|:|:.::|:|::.|.|:||||||:||
  Fly   777 STPESIL--GRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQ 839

  Fly   374 KQKRIVSSV---TPSMTGHGSAGFGY 396
            |:|||..|:   :|:.|...|..|||
  Fly   840 KEKRINPSLDLDSPTGTPLSSHAFGY 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 45/76 (59%)
Homeobox 323..377 CDD:395001 24/53 (45%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 40/66 (61%)
Homeobox 789..842 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.