DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and ONECUT1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_004489.1 Gene:ONECUT1 / 3175 HGNCID:8138 Length:465 Species:Homo sapiens


Alignment Length:406 Identity:78/406 - (19%)
Similarity:128/406 - (31%) Gaps:182/406 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YHH------HSMSGP-------------------------PQRPLQ-----ENPFSRQMHH---- 141
            |||      ||::||                         |.:||.     .:.|....||    
Human    68 YHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHHHHH 132

  Fly   142 ---------------------------SMDQLDM---LDPTGSMTTLAPISESPLTPTHQHLHGS 176
                                       ||:.|..   .|..|...:|:|:|.|.|        ||
Human   133 HHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLSPLSSSGL--------GS 189

  Fly   177 YHSMNHMMSH---------------------HHPGTLSGH--------TGG---------HHGHS 203
            .|:....:.|                     |||..|..|        :.|         ||.|:
Human   190 IHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHA 254

  Fly   204 AVH--------------HPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKA 254
            .::              :|.:|.|..:.|      ::..::|....:...:||...:.:..:.:|
Human   255 HLNAQGHGQLLGTAREPNPSVTGAQVSNG------SNSGQMEEINTKEVAQRITTELKRYSIPQA 313

  Fly   255 LANLKLPGVGALSQSTICRFESLTLSHNNMIALKP------------ILQAWLEEAEAQ------ 301
            :          .:|..:||.:. ||| :.:...||            .:..||:|.|.|      
Human   314 I----------FAQRVLCRSQG-TLS-DLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALR 366

  Fly   302 -AKNKRRDPD-------APSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLD 358
             |..||::.:       .|        |:.|......::|:|.|.|....|||.|....|:::|.
Human   367 LAACKRKEQEHGKDRGNTP--------KKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLG 423

  Fly   359 LKKNVVRVWFCNQRQK 374
            |:.:.|..:|.|.|::
Human   424 LELSTVSNFFMNARRR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 15/88 (17%)
Homeobox 323..377 CDD:395001 16/52 (31%)
ONECUT1NP_004489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..141 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..290 4/31 (13%)
CUT 290..362 CDD:396794 17/83 (20%)
HOX 385..440 CDD:197696 18/63 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.