DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Pou1f1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006248036.1 Gene:Pou1f1 / 25517 RGDID:3367 Length:317 Species:Rattus norvegicus


Alignment Length:293 Identity:104/293 - (35%)
Similarity:147/293 - (50%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QMHHS-MDQLDMLD-PTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGH- 199
            :|||| .:.|...: .|..|:|:..|.....||...|.:.|..:|.:..:..|....|.|.|.. 
  Rat    26 RMHHSAAEGLPASNHATNVMSTVPSILSLIQTPKCLHTYFSMTTMGNTATGLHYSVPSCHYGNQP 90

  Fly   200 -----------------------HGHSAVHHPVITAAVAAAGLHP-------------DTDT-DP 227
                                   ||...:|.|::.....|:....             |.|: :.
  Rat    91 STYGVMAGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEEPIDMDSPEI 155

  Fly   228 RELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGA-LSQSTICRFESLTLSHNNMIALKPIL 291
            ||||.||..||.||||||.||.:||:|||.:.    |: .||:||||||:|.||..|...||.||
  Rat   156 RELEQFANEFKVRRIKLGYTQTNVGEALAAVH----GSEFSQTTICRFENLQLSFKNACKLKAIL 216

  Fly   292 QAWLEEAE--AQAKNKRRDPDAPSVLPAGEKKRK-RTSIAAPEKRSLEAYFAVQPRPSGEKIAAI 353
            ..||||||  ....|::        :.|.|:||| ||:|:...|.:||.:|....:||.::|..:
  Rat   217 SKWLEEAEQVGALYNEK--------VGANERKRKRRTTISIAAKDALERHFGEHSKPSSQEIMRM 273

  Fly   354 AEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSM 386
            ||:|:|:|.||||||||:||::||:.:|:..|:
  Rat   274 AEELNLEKEVVRVWFCNRRQREKRVKTSLNQSL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 44/78 (56%)
Homeobox 323..377 CDD:395001 26/54 (48%)
Pou1f1XP_006248036.1 POU 150..224 CDD:197673 43/77 (56%)
Homeobox 243..297 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.