DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Hdx

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001074018.1 Gene:Hdx / 245596 MGIID:2685226 Length:692 Species:Mus musculus


Alignment Length:383 Identity:71/383 - (18%)
Similarity:119/383 - (31%) Gaps:124/383 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YSPSYRSSEQMRRCMPNPSIHISSSCDSLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAE 88
            |.|.:........|...|:|. ...|.:....:.|..||..:.:..|    |..|.:....:.||
Mouse   233 YKPEHAGLASHNLCGQKPTIR-DPCCRTQNLEIREVFSLAVSDYPQR----ILGGNSTQKPASAE 292

  Fly    89 ------ALAAVDIQKHQAQHVH-SQMPSQIKHDVMYHHHSMSGPPQRPLQENPFS------RQMH 140
                  |:...|.:...|:... :.|.:||   ..|.....||...|  .||..:      |.: 
Mouse   293 GTCLSIAMETGDAEDEYAREEELASMGAQI---TSYSRFYESGNSLR--AENQSTNLPGPGRNL- 351

  Fly   141 HSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAV 205
                      |...|..:..:|::.|..|.     .||             |:..|..|...|.:
Mouse   352 ----------PNSQMVNIRDLSDNVLYQTR-----DYH-------------LTPRTSLHTASSTM 388

  Fly   206 HHPVITAAVAAAGLHPDTDTDPRELEAFAERF-KQRRIKLGVTQADVGKALANLKLPGVGALSQS 269
            :                ::|:|.. ..|:..| ...:::|...|.:. :...||.:|.:...|: 
Mouse   389 Y----------------SNTNPSR-SNFSPHFVSSNQLRLSQNQNNY-QISGNLSVPWITGCSR- 434

  Fly   270 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRS 334
                              |..||                              .||..:..:..:
Mouse   435 ------------------KRALQ------------------------------DRTQFSDRDLAT 451

  Fly   335 LEAYFAVQPRPSG----EKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTG 388
            |:.|:.......|    |||.|:|.:|::...:||.|..|:|:|.:.:...|.|...|
Mouse   452 LKKYWDNGMTSLGSVCREKIEAVAIELNVDCEIVRTWIGNRRRKYRLMGIEVPPPRGG 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 13/77 (17%)
Homeobox 323..377 CDD:395001 17/57 (30%)
HdxNP_001074018.1 HOX 4..59 CDD:197696
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..136
homeodomain 441..497 CDD:238039 17/55 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..541 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 647..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.