Sequence 1: | NP_524876.1 | Gene: | acj6 / 47080 | FlyBaseID: | FBgn0000028 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038661.2 | Gene: | Pou5f1 / 18999 | MGIID: | 101893 | Length: | 352 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 83/203 - (40%) |
---|---|---|---|
Similarity: | 106/203 - (52%) | Gaps: | 37/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 221 PDTDTD----PRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGV---GALSQSTICRFESLT 278
Fly 279 LSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKRSLEAYFAVQP 343
Fly 344 RPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKR---------------------IVSSVTPSMT 387
Fly 388 GHGSAGFG 395 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
acj6 | NP_524876.1 | POU | 222..299 | CDD:197673 | 40/83 (48%) |
Homeobox | 323..377 | CDD:395001 | 29/53 (55%) | ||
Pou5f1 | NP_038661.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 91..115 | ||||
POU | 131..205 | CDD:197673 | 40/79 (51%) | ||
DNA binding. /evidence=ECO:0000269|PubMed:23376973, ECO:0007744|PDB:3L1P | 173..179 | 4/5 (80%) | |||
DNA binding. /evidence=ECO:0000269|PubMed:23376973, ECO:0007744|PDB:3L1P | 186..189 | 1/2 (50%) | |||
Homeobox | 226..279 | CDD:278475 | 29/52 (56%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847032 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3802 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |