DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Pou3f1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_035271.1 Gene:Pou3f1 / 18991 MGIID:101896 Length:449 Species:Mus musculus


Alignment Length:259 Identity:104/259 - (40%)
Similarity:139/259 - (53%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHS 203
            :||::.:      .|....|.|   ||  |.|...||  |:..|           .|.||.|..:
Mouse   185 LHHALHE------DGHEAQLEP---SP--PPHLGAHG--HAHGH-----------AHAGGLHAAA 225

  Fly   204 AVHHPVITAAVAAAGLHPDTDT-DPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALS 267
            |..||......::.|.|.|.|. ...:||.||::|||||||||.||||||.||..|.   ....|
Mouse   226 AHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLY---GNVFS 287

  Fly   268 QSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEK 332
            |:||||||:|.||..||..|||:|..||||.::.:.:   ..:...:...|.|::|||||....|
Mouse   288 QTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGS---PTNLDKIAAQGRKRKKRTSIEVGVK 349

  Fly   333 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY 396
            .:||::|...|:||..:|..:|:.|.|:|.||||||||:|||:||    :||      :||.|:
Mouse   350 GALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKR----MTP------AAGAGH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 45/77 (58%)
Homeobox 323..377 CDD:395001 28/53 (53%)
Pou3f1NP_035271.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..251 24/89 (27%)
POU 245..319 CDD:197673 44/76 (58%)
Homeobox 340..393 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..449 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.