DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and POU5F2

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_694948.1 Gene:POU5F2 / 134187 HGNCID:26367 Length:328 Species:Homo sapiens


Alignment Length:165 Identity:65/165 - (39%)
Similarity:95/165 - (57%) Gaps:22/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGA-----LSQSTICRFESLTLSHNNMIAL 287
            :||:..|:..:|:|:.||.:|||||.|        |||     |||:||||||:..||..||..|
Human   124 KELQQLAKELRQKRLSLGYSQADVGIA--------VGALFGKVLSQTTICRFEAQQLSVANMWKL 180

  Fly   288 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAPEKR---SLEAYFAVQPRPSGEK 349
            :|:|:.||:|.||:  |.........:|....|.|:    |:.|:|   |||.:|...|:|:.::
Human   181 RPLLKKWLKEVEAE--NLLGLCKMEMILQQSGKWRR----ASRERRIGNSLEKFFQRCPKPTPQQ 239

  Fly   350 IAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTP 384
            |:.||..|.|:|:||||||.|:.:...|..:..:|
Human   240 ISHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 35/75 (47%)
Homeobox 323..377 CDD:395001 22/56 (39%)
POU5F2NP_694948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Pou 124..192 CDD:278582 35/75 (47%)
Homeobox <225..261 CDD:278475 17/35 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.