DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Pou6f1

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_038934171.1 Gene:Pou6f1 / 116545 RGDID:620615 Length:615 Species:Rattus norvegicus


Alignment Length:387 Identity:104/387 - (26%)
Similarity:164/387 - (42%) Gaps:102/387 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STTDKMKMSAPSCFPGRYSPSYRSSE-QMRRCMP----NPSIHISSSCDSLESRLLEDASLLCNS 66
            :|...:..:.|| .||..||...::: |:...:|    :.|:...:...||:.:.: ...||.|:
  Rat   303 TTAPVITNTIPS-MPGISSPILTNAQGQVIGALPWVVNSASVATPAPAQSLQVQAV-TPQLLLNA 365

  Fly    67 WSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQ 131
                 .|.:.|           .||:..:.:..|....|...|..|.:|.....:.:.||...:.
  Rat   366 -----QGQVIA-----------TLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVIL 414

  Fly   132 ENPFSRQMHHSMDQLDMLDPTGSMTTLAPI----SESPLTPTHQHLHGSYHSMNHMMSHHHPGTL 192
            .:|           ...|.|:.|    |||    ||:|             :::.::|..|.   
  Rat   415 TSP-----------APALKPSAS----APIPITCSETP-------------TVSQLVSKPHT--- 448

  Fly   193 SGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDP---RELEAFAERFKQRRIKLGVTQADVGKA 254
                                        |..|.|.   .|:..||:.||.||:.||:||..||:|
  Rat   449 ----------------------------PSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQA 485

  Fly   255 LANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRD-----PDAPSV 314
            |...:.|   |.|||.|||||.|.::..:...|||:|:.||.|||.:.:..:::     ...|| 
  Rat   486 LTATEGP---AYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPS- 546

  Fly   315 LPAGEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQK 376
                :|:::|||.......:|.|||...|.|:|::|..||::|:..:.||||||||:||..|
  Rat   547 ----KKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLK 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 35/79 (44%)
Homeobox 323..377 CDD:395001 25/54 (46%)
Pou6f1XP_038934171.1 PHA03247 <45..430 CDD:223021 32/159 (20%)
POU 453..527 CDD:197673 34/76 (45%)
Homeobox 551..605 CDD:395001 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350531
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.