DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acj6 and Pou2f3

DIOPT Version :9

Sequence 1:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001099215.1 Gene:Pou2f3 / 116544 RGDID:621691 Length:430 Species:Rattus norvegicus


Alignment Length:274 Identity:113/274 - (41%)
Similarity:137/274 - (50%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SMSGPPQRPLQENPFSRQMHHSMDQLDMLDP--TGSMTTLAPISESPLTPTHQHLHGSYHSMNHM 183
            |.:.|.|:.||.|..|.....|...|....|  |........:|.|.|.|   ||..|.|...  
  Rat   106 SQTPPGQQGLQPNLLSFPQQQSTLLLPQTGPGLTSQAVGRPGLSGSSLEP---HLEASQHLPG-- 165

  Fly   184 MSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQ 248
             ..|.||     .||:                      |..||..|||.||:.|||||||||.||
  Rat   166 -PKHLPG-----PGGN----------------------DEPTDLEELEKFAKTFKQRRIKLGFTQ 202

  Fly   249 ADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDA-- 311
            .|||.|:.  ||.| ...||:||.|||:|.||..||..|||:|:.||.:||:...    ||.|  
  Rat   203 GDVGLAMG--KLYG-NDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPS----DPSAST 260

  Fly   312 PSVLPA-----GEKKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ 371
            ||..|.     |.|::|||||....:.:||..|...|:||.|:|:.|||:|.::|.||||||||:
  Rat   261 PSSYPTLSEVFGRKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNR 325

  Fly   372 RQKQKRIVSSV-TP 384
            |||:|||...| ||
  Rat   326 RQKEKRINCPVATP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acj6NP_524876.1 POU 222..299 CDD:197673 44/76 (58%)
Homeobox 323..377 CDD:395001 29/53 (55%)
Pou2f3NP_001099215.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..180 17/83 (20%)
POU 176..250 CDD:197673 44/76 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271 8/25 (32%)
Homeobox 277..330 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.