DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qsm and F52C9.5

DIOPT Version :10

Sequence 1:NP_652049.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001367876.1 Gene:F52C9.5 / 186097 WormBaseID:WBGene00018675 Length:645 Species:Caenorhabditis elegans


Alignment Length:233 Identity:45/233 - (19%)
Similarity:69/233 - (29%) Gaps:90/233 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DED-------SAPVYGLGVNYLDVTDTHTS-SETLIFKGCTV-------------DPYL----FE 254
            |||       |||:..|..| .|..|.|.. :||:  :..||             ..:|    ||
 Worm   235 DEDSPPSPPPSAPIVALATN-TDKRDEHEEMTETI--EDITVASPSSDSCPRGKQSTFLRTEGFE 296

  Fly   255 NFNTID-----GDI--------------LSAKFKAFKF-------------------------PD 275
            .|:..|     ||:              ::.|.|:|.|                         .|
 Worm   297 LFSHDDQELVVGDVAECAKACIENKINGVALKCKSFDFLSSTSTCAFTSEAAVPVGNGQLKQRED 361

  Fly   276 SSYVQFRATVNVCLDKCLGTQCSNN---------QVGFGRRKREISSANKVYEISLAMFLQVQDI 331
            :||.:     .:|:.|.....|.:.         .|||.....:..|....::..|..:    .:
 Worm   362 ASYHE-----KICVSKSFVESCPSTFFSRHPQMILVGFAESVSDSPSFEHCFDTCLNSY----QL 417

  Fly   332 EGVNKNEVLQLEEKLRELKLANQRLARNSRGNFAMEQT 369
            .|.|....:...|:.:...:.|.......|..|..|.|
 Worm   418 FGFNCTSGMYYFEENQLNCILNSENRNTQRELFTEENT 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qsmNP_652049.1 ZP 30..298 CDD:214579 31/151 (21%)
F52C9.5NP_001367876.1 PAN_AP 132..213 CDD:214680
PAN_1 288..369 CDD:459635 14/85 (16%)
PAN_AP_HGF 383..462 CDD:238532 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.