DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCK1 and cdc15

DIOPT Version :9

Sequence 1:NP_001278928.1 Gene:NCK1 / 4690 HGNCID:7664 Length:377 Species:Homo sapiens
Sequence 2:NP_593322.1 Gene:cdc15 / 2541975 PomBaseID:SPAC20G8.05c Length:927 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:52/255 - (20%)
Similarity:95/255 - (37%) Gaps:68/255 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    41 VRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVD----PG 101
            :|:|.:.....||..:.|::|..:.|..:: ..:|.:.:       .|..|||..:...    .|
pombe   690 LRHSRSNMSRSPSPMLSRRSSTLRPSFERS-ASSLSVRQ-------SDVVSPAPSTRARGQSVSG 746

Human   102 ERLYDLNMPAYVKFNYMAEREDELSL------------IKGTKVIVMEKCSDGWWRGSYNGQVGW 154
            ::....:|..|.::|   :.:.:||:            .:.:.|:..:|.:........||    
pombe   747 QQRPSSSMSLYGEYN---KSQPQLSMQRSVSPNPLGPNRRSSSVLQSQKSTSSNTSNRNNG---- 804

Human   155 FPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQ----------------------------- 190
               .|......|.:|...||:|.:....|:..:|.:                             
pombe   805 ---GYSGSRPSSEMGHRYGSMSGRSMRQVSQRSTSRARSPEPTNRNSVQSKNVDPRATFTAEGEP 866

Human   191 VLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKI---NGMVGLVPKNYV 247
            :|..|.|||.:.:...||::|:|||.:.|:...|:.  ||....|   |...||.|.|:|
pombe   867 ILGYVIALYDYQAQIPEEISFQKGDTLMVLRTQEDG--WWDGEIINVPNSKRGLFPSNFV 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCK1NP_001278928.1 SH3_Nck1_1 3..61 CDD:212833 5/19 (26%)
SH3_Nck1_2 108..162 CDD:212834 10/65 (15%)
SH3_Nck1_3 193..249 CDD:212837 21/58 (36%)
SH2_Nck1 280..376 CDD:198271
cdc15NP_593322.1 F-BAR_PombeCdc15_like 28..263 CDD:153335
SH3 869..925 CDD:214620 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4102
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.