Sequence 1: | NP_001278928.1 | Gene: | NCK1 / 4690 | HGNCID: | 7664 | Length: | 377 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_593322.1 | Gene: | cdc15 / 2541975 | PomBaseID: | SPAC20G8.05c | Length: | 927 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 255 | Identity: | 52/255 - (20%) |
---|---|---|---|
Similarity: | 95/255 - (37%) | Gaps: | 68/255 - (26%) |
- Green bases have known domain annotations that are detailed below.
Human 41 VRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVD----PG 101
Human 102 ERLYDLNMPAYVKFNYMAEREDELSL------------IKGTKVIVMEKCSDGWWRGSYNGQVGW 154
Human 155 FPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQ----------------------------- 190
Human 191 VLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKI---NGMVGLVPKNYV 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NCK1 | NP_001278928.1 | SH3_Nck1_1 | 3..61 | CDD:212833 | 5/19 (26%) |
SH3_Nck1_2 | 108..162 | CDD:212834 | 10/65 (15%) | ||
SH3_Nck1_3 | 193..249 | CDD:212837 | 21/58 (36%) | ||
SH2_Nck1 | 280..376 | CDD:198271 | |||
cdc15 | NP_593322.1 | F-BAR_PombeCdc15_like | 28..263 | CDD:153335 | |
SH3 | 869..925 | CDD:214620 | 21/58 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 43 | 1.000 | Domainoid score | I4102 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |