DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM2 and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:458 Identity:110/458 - (24%)
Similarity:171/458 - (37%) Gaps:114/458 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   142 FREVVSPQEFKQGEDAEVVCRVSSSPAPAVSWLY---------HNEEVTTISDNRFAMLANNN-- 195
            |.:|:.......|.:.::.|.|.:..:..|:|::         ||..:|  .:.|.::..:.:  
  Fly    54 FTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVIT--RNPRISVTHDKHDK 116

Human   196 -----LQILNINKSDEGIYRCE-GRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMT 254
                 |.|.|:.:.|.|.|.|: ..|.|:.:..|    |.|.|||.|.....|.:.....|:.:|
  Fly   117 HRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGF----VKVVVPPNIDDALTSSDIIVREGDNVT 177

Human   255 FSCRASGSPEPAISWFR-NGKLIEENEKYILKGSNTE-LTVRNIINSDGGPYVCRATN------- 310
            ..|:|.|||||.|.|.| :|..|..|:...:....|: |.:..|.....|.|:|.|:|       
  Fly   178 LRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVS 242

Human   311 ---KAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGD 372
               |...|    |..:...||  ||.......|  :||.|..|..|.....|.|..|.. .||..
  Fly   243 KRIKVSVD----FSPMVWIPH--QLVGIPIGFN--ITLECFIEANPTSLNYWTRENDQM-ITESS 298

Human   373 K----SLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQT 433
            |    ::.|....|   .:..|.|.:|:.||.|.|.|.|.:..|        |::      .|..
  Fly   299 KYKTETIPGHPSYK---ATMRLTITNVQSSDYGNYKCVAKNPRG--------DMD------GNIK 346

Human   434 IYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNL-KTYSTGRKMILE---IAPTSDND 494
            :|              .|:||.:         .|...||.| :|.:|..::.|:   ..|.:.|.
  Fly   347 LY--------------MSSPPTT---------QPPPTTTTLRRTTTTAAEIALDGYINTPLNGNG 388

Human   495 FGRYNCTATNHIGTRFQEYILALADVPSS-PYGVKIIELSQTTAKVSFNKP-----------DSH 547
            .|......||.:          :|...|| .|...:.|:.::..|::.:.|           .||
  Fly   389 IGIVGEGPTNSV----------IASGKSSIKYLSNLNEIDKSKQKLTGSSPKGFDWSKGKSSGSH 443

Human   548 GGV 550
            |.:
  Fly   444 GNL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274
I-set 47..136 CDD:254352
I-set 142..218 CDD:254352 19/92 (21%)
IGc2 153..214 CDD:197706 16/77 (21%)
Ig 233..326 CDD:299845 30/104 (29%)
I-set 240..323 CDD:254352 27/94 (29%)
Ig5_NCAM-2 325..422 CDD:143278 28/100 (28%)
IG_like 333..420 CDD:214653 24/90 (27%)
IG_like 438..515 CDD:214653 15/80 (19%)
IGc2 439..507 CDD:197706 15/71 (21%)
FN3 521..613 CDD:238020 9/42 (21%)
fn3 619..703 CDD:278470
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/101 (21%)
Ig 69..139 CDD:143165 15/71 (21%)
IG_like 165..249 CDD:214653 25/83 (30%)
IGc2 172..237 CDD:197706 23/64 (36%)
IG_like 267..348 CDD:214653 26/100 (26%)
Ig 270..339 CDD:299845 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.