DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM2 and DIP-theta

DIOPT Version :9

Sequence 1:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:695 Identity:149/695 - (21%)
Similarity:236/695 - (33%) Gaps:191/695 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   117 RCQATDAKGQTQEATVVLEIYQKL----TFREVVSPQEFKQGEDAEVVCRVSSSPAPAV------ 171
            |.|...|.|:.|....:.||..:|    ....|||           ::|...:.|..|.      
  Fly    18 RRQRRRAAGKLQRKREMPEISSRLIVATATAAVVS-----------IICLSLALPGCAAQESDDE 71

Human   172 SWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDII---VIVNVP 233
            ..|:|.:::            ::..|...|.:|:|..:......|.:.:.:..:.|   .:||..
  Fly    72 GELHHLDQM------------HHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAI 124

Human   234 PAISMPQKSF-----NATAERGEEMTFSCRASGSPEPAISWFR---------NGKLIEENEKYIL 284
            |...:|:  |     |.|.....|....|.........|:|.|         ...:|.:|.:..:
  Fly   125 PEKDLPK--FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSI 187

Human   285 KGSNTE---LTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNETTY---ENGQV 343
            ..:...   |.:|::..||.|.|:|: .|......:..:|.|.|.|.|:.....|..   |...|
  Fly   188 THAEKRAWILRIRDVKESDKGWYMCQ-INTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNV 251

Human   344 TLVCDAEGEPIPEITWKRAVDGFTFTEGDK--SLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCE 406
            ||.|.|.|.|.|.|||:|        ||.:  .|....|....:| |.|.|..|...:.|.|.|.
  Fly   252 TLKCAATGSPTPTITWRR--------EGGELIPLPNGAEAVAYNG-SFLTIAKVNRLNMGAYLCI 307

Human   407 AASRIGGH-QKSMYLDIEYAPK-FISNQTIYYSWEGNPINISCDVKSNPPASIHW-RRDKLVLPA 468
            |::.|... .|.:.|.:.:.|. :|.||.:..:...| |.:.|..::.|.:..:| :.|.:::|.
  Fly   308 ASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQN-ITLECQSEAYPKSINYWMKNDTIIVPG 371

Human   469 KNTTNLKTYSTGRK--MILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIE 531
            :.... :|:.:|.|  |.|.|......|||.|.|.|.|.:|              .:...:|:..
  Fly   372 ERFVP-ETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLG--------------DTDGAIKLYH 421

Human   532 LSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLN-------NLEPNTT 589
            :.|||...:.....|...||:    |.||      :...:.:|.......|       |.:.|| 
  Fly   422 IPQTTTMTTMAPTVSINTVPV----VLVK------YNKEQRYGSSQNSNTNPYNFNPGNSQQNT- 475

Human   590 YEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHG---------------QPSSGKSFKLSIT 639
             :::....|.||.               :.||..::.               ..||..|...|..
  Fly   476 -KLQRGKSNSKGS---------------DQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSR 524

Human   640 KQD----------------DGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYE 688
            .:|                |.||       .|||..|.........:...|.  |:.:|...|: 
  Fly   525 GRDHHQQQHHQQQQQNHGSDHGA-------SYRSDGKSPHLTNHDAKSLTDD--LDRMQDLKGW- 579

Human   689 VQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLG 733
                 |:||....|.                    |||..::|:|
  Fly   580 -----ASRLSPISPI--------------------LGLSMILGVG 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274 6/19 (32%)
I-set 47..136 CDD:254352 5/18 (28%)
I-set 142..218 CDD:254352 13/81 (16%)
IGc2 153..214 CDD:197706 9/66 (14%)
Ig 233..326 CDD:299845 22/109 (20%)
I-set 240..323 CDD:254352 19/99 (19%)
Ig5_NCAM-2 325..422 CDD:143278 33/102 (32%)
IG_like 333..420 CDD:214653 29/92 (32%)
IG_like 438..515 CDD:214653 21/79 (27%)
IGc2 439..507 CDD:197706 20/70 (29%)
FN3 521..613 CDD:238020 18/98 (18%)
fn3 619..703 CDD:278470 21/114 (18%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 19/93 (20%)
IG_like 137..230 CDD:214653 19/93 (20%)
IG_like 240..324 CDD:214653 30/92 (33%)
IGc2 247..310 CDD:197706 26/71 (37%)
Ig 327..419 CDD:299845 25/107 (23%)
IG_like 343..420 CDD:214653 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.