DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:380 Identity:89/380 - (23%)
Similarity:144/380 - (37%) Gaps:72/380 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    99 TGEDGSESE---ATVNVKIFQKLMF----KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGR 156
            ||.:|:...   :|:|..|.:...|    :|...|    .|.:..:.|.|.:.....:.|.|..:
  Fly    30 TGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVP----AGRNVKLACSVKNLGSYKVAWMHFEQ 90

Human   157 DVILKKDVRFIVLSNN----------------YLQIRGIKKTDEGTYRCE-GRILARGEINFKDI 204
            ..||  .|...|::.|                :|.|..:::.|.|.|.|: ..:.|:.:..|   
  Fly    91 SAIL--TVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGF--- 150

Human   205 QVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTK-DGEQIEQEEDDEKYIFSDD 268
             |.|.|||.|.......:.....|.:|||.|.|:|.||||:.|.: ||.:|...:..|.:....|
  Fly   151 -VKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETD 214

Human   269 SSQLTIKKVDKNDEAEYICIAENKAGEQ-DATIHLKVFAKPKITYVENQTAMELEEQVTLTCEAS 332
            |  |.::::.:.....|:|||.|..... ...|.:.|...|.:........:.:...:||.|...
  Fly   215 S--LELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIE 277

Human   333 GDPIPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVV 397
            .:| .|:.:              |||...|.:.....::.                ||:.||   
  Fly   278 ANP-TSLNY--------------WTRENDQMITESSKYKT----------------ETIPGH--- 308

Human   398 RSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYT 452
            .|:.....||:.::|.:|.|.|.|.|.|..|....::.|.:...|..|.|....|
  Fly   309 PSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTT 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 5/18 (28%)
IG 124..190 CDD:214652 16/81 (20%)
Ig 211..307 CDD:325142 29/97 (30%)
Ig 306..438 CDD:325142 26/131 (20%)
Ig_3 447..519 CDD:316449 2/6 (33%)
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/105 (21%)
Ig 69..139 CDD:143165 15/71 (21%)
IG_like 165..249 CDD:214653 25/85 (29%)
IGc2 172..237 CDD:197706 24/66 (36%)
IG_like 267..348 CDD:214653 24/114 (21%)
Ig 270..339 CDD:299845 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.