DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:465 Identity:100/465 - (21%)
Similarity:165/465 - (35%) Gaps:121/465 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   218 QNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQ--------IEQEEDDEKYIFSDDSSQLTI 274
            |.|.|.|..:|:...|.|..|......::|.....|        :..........::|::..|.:
  Fly    48 QPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHV 112

Human   275 KKVDKNDEAEYIC-IAENKAGEQDATIHLKVFAKPKITYVE---NQTAMELEEQVTLTCEASGDP 335
            .:..::|...|:| :..|....|..  :|:|...|.|..:|   :..|:...:.:.:||.|.|.|
  Fly   113 NQAHQDDRGYYMCQVNTNPMISQVG--YLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFP 175

Human   336 IPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSH 400
            .|.|.||               |.:.:|:      .|.::|                  .|:...
  Fly   176 APKIIWR---------------REDGEEI------AVEKKK------------------KVLVYD 201

Human   401 ARVSSLTLKSIQYTDAGEYICTASNTIGQD-SQSMYLEVQYAPKLQGP-VAVYTWEGNQVNITCE 463
            |.|  |.|..:...:.|.|:|.|:|.:... |:.:.|:|:::|.:..| ..|....|..|.|.|.
  Fly   202 ADV--LPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCH 264

Human   464 VFAYPSATISW-FRDGQLLPSSNYSNIKIYNTPSASY-LEVTPDSENDFGNYNCTAVNRIGQESL 526
            ..|:|.|.|.| :....:|||..|......|:..|.. |.:......|||||.|.:.|.:|:...
  Fly   265 TEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEG 329

Human   527 EFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAKEA 591
            ...:.:...||:||                                     ::|.|:    ..|:
  Fly   330 SIRVYEIPLPSTPS-------------------------------------KQVTHT----TVES 353

Human   592 SMEGIV------TIVGLKPETTYAVR------LAALNGKGLGEISAASEFKTQPVQGEPSAPKLE 644
            ....|:      |...|:.:..||::      .|:.:..| |..||||...:......|.     
  Fly   354 RENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSG-GSSSAASSSSSMQTSALPG----- 412

Human   645 GQMGEDGNSI 654
               |..|||:
  Fly   413 ---GVAGNSL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig 211..307 CDD:325142 19/97 (20%)
Ig 306..438 CDD:325142 29/135 (21%)
Ig_3 447..519 CDD:316449 24/74 (32%)
FN3 534..631 CDD:238020 19/108 (18%)
fn3 639..720 CDD:306538 4/16 (25%)
Trypan_PARP <792..>864 CDD:330686
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 17/93 (18%)
Ig 145..238 CDD:416386 29/133 (22%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 3/19 (16%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 2/21 (10%)
Ig strand E 203..209 CDD:409353 3/7 (43%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 27/90 (30%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.