DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and CG34353

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:674 Identity:140/674 - (20%)
Similarity:237/674 - (35%) Gaps:228/674 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   116 QKLMFKNAP------TPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYL 174
            |.:|.||.|      ...:|..||..|:.|:|.::....:.||                      
  Fly    78 QSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWK---------------------- 120

Human   175 QIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEG 239
              |||            .||..|.         |.|.|  ..|..:||                |
  Fly   121 --RGI------------AILTAGS---------VKVTP--DPRVRLVN----------------G 144

Human   240 FPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYIC-IAENKAGEQDATIHLK 303
            |                              .|.|:.....|..:||| ||.....|...|:  :
  Fly   145 F------------------------------NLQIRDALPTDAGDYICQIATMDPREITHTV--E 177

Human   304 VFAKPKITYVENQTAMELEE--QVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVHA 366
            :...|:|.::.....:::::  .|.:.|.|:|:|:|::|| :...||                  
  Fly   178 ILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTW-SRKNNI------------------ 223

Human   367 PWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDS 431
                             .|...|.|..|:          |:::::.....|.|||||:|.:||.:
  Fly   224 -----------------LPNGEEKLHSHV----------LSIENVDRHKGGVYICTANNRVGQPA 261

Human   432 QS-MYLEVQYAPKL--QGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYN 493
            .| :.|.|.::|::  :.|| |::.||::..:.|.|.......:.||:|...|.::..   .|..
  Fly   262 SSQVVLHVLFSPEISVERPV-VFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTER---HIME 322

Human   494 TPSASY-LEVTPDSENDFGNYNCTAVNRIG--QESLEFILVQADTP-----SSPSIDQVEPYSST 550
            |..:.: |.:......|||||:|.|.|::|  :::|:.    :..|     :||.|.|   |...
  Fly   323 TRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQL----SGKPNVAVFNSPPISQ---YKDR 380

Human   551 AQVQFDEPEATGGVPILKYKAEWRAV--GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLA 613
            ..:.:   ......||.:||..:|.:  |.||..:. .|:..:|.....:...:.....:|.|: 
  Fly   381 YNISW---AVDSHSPIEEYKLSFRKLPQGHEVVGNA-IDSSSSSSSMSSSSSQMYGSGLHAHRI- 440

Human   614 ALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAL 678
               |..:|.:|..|.               .|.....||.|               |:      .
  Fly   441 ---GSNMGGLSGLSG---------------SGSYSGYGNVI---------------HW------G 466

Human   679 SSEWKPEIRLPS--GSDH------VMLKSLDWNAEYEVYVVAENQQGKSKAAH-FVFRTSAQPTA 734
            .::|: .:.||:  .|.|      .|::.||.:..||..|.:.|:.|.|...: |||.||:....
  Fly   467 HNDWR-NVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSNDGP 530

Human   735 IPANGSPTSGLSTGAIVGILIVIF 758
            :..:.....|||...:..:.:..:
  Fly   531 VDLSTFLNHGLSDNEMRDLSVTFY 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 12/71 (17%)
Ig 211..307 CDD:325142 16/96 (17%)
Ig 306..438 CDD:325142 28/134 (21%)
Ig_3 447..519 CDD:316449 21/72 (29%)
FN3 534..631 CDD:238020 22/103 (21%)
fn3 639..720 CDD:306538 18/88 (20%)
Trypan_PARP <792..>864 CDD:330686
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 31/174 (18%)
Ig 103..177 CDD:143165 29/168 (17%)
IG_like 191..269 CDD:214653 26/123 (21%)
IGc2 198..258 CDD:197706 22/105 (21%)
I-set 273..360 CDD:254352 25/90 (28%)
Ig 290..359 CDD:143165 18/71 (25%)
FN3 <466..524 CDD:238020 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.