DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and dpr11

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:180 Identity:45/180 - (25%)
Similarity:68/180 - (37%) Gaps:27/180 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    33 VGESKFFLCQVAGDAKDKDISWFS-PNGEKLTPNQ------QRISVVWNDDSSSTLTIYNANIDD 90
            :|...:..|:|. ...:|.:||.. .:|..||.::      ||...:...|...||.|......|
  Fly   131 IGTHAYLPCRVK-QLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARD 194

Human    91 AGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEF-REGEDAVIVCDVVSSL-PPT-IIWK 152
            ||.|:|.|:.|....:...:.|.:.:..:...   |..: :.|.:.|:.|.|..:| ||| |:|.
  Fly   195 AGSYECQVSTEPKVSARVQLQVV
VPRTEILGE---PDRYVKAGSNVVLRCIVRGALEPPTFIMWY 256

Human   153 HKGRDVILKKDVRFIVLSNNY-------------LQIRGIKKTDEGTYRC 189
            |....:..........|..|.             |.|...||.|.|.|.|
  Fly   257 HGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 23/88 (26%)
IG 124..190 CDD:214652 22/82 (27%)
Ig 211..307 CDD:325142
Ig 306..438 CDD:325142
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
dpr11NP_001262320.1 I-set 125..216 CDD:254352 22/85 (26%)
Ig 127..217 CDD:299845 22/86 (26%)
IG_like 227..320 CDD:214653 22/80 (28%)
IGc2 234..311 CDD:197706 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.